• Gene id: 7980

Gene Summary

• Gene Symbol: TFPI2   Gene   UCSC   Ensembl
• Aliases: PP5, REF1, TFPI-2
• Gene name: tissue factor pathway inhibitor 2
• Alternate names: tissue factor pathway inhibitor 2, placental protein 5, retinal pigment epithelium cell factor 1,
• Gene location: 7q21.3 (93890990: 93885396)     Exons: 5     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa/tissue factor, factor Xa, plasmin, trypsin, chymotryspin and plasma kallikrein. This gene has bee
• OMIM: 600033

Protein Summary

• Protein general information: P48307  
  • Name: Tissue factor pathway inhibitor 2 (TFPI 2) (Placental protein 5) (PP5)
  • Length: 235  
  • Mass: 26,934
  • Tissue specificity: Widely expressed. Expressed at higher level in thymus and spleen. {ECO
• Sequence:

  MDPARPLGLSILLLFLTEAALGDAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANN
  FYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCA
  PKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKKKKKMPKLRFAS
  RIRKIRKKQF

• Structural information:
  • Protein Domains: BPTI/Kunitz (36-86)
    BPTI/Kunitz (96-149)
    BPTI/Kunitz (158-208)
  • Interpro: IPR002223  IPR036880  IPR020901  IPR008296  
  • Prosite: PS00280 PS50279
  • CDD: cd00109
  • PDB: 1ZR0
  • PDBsum: 1ZR0
  • STRING: ENSP00000222543
• Other Databases: GeneCards:  TFPI2  Malacards:  TFPI2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005201	extracellular matrix structural constituent	TAS	molecular function
GO:0005578	proteinaceous extracellular matrix	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007596	blood coagulation	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005201	extracellular matrix structural constituent	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007596	blood coagulation	IEA	biological process
GO:0007599	hemostasis	IEA	biological process
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0005201	extracellular matrix structural constituent	TAS	molecular function
GO:0005578	proteinaceous extracellular matrix	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 6601587
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 6601587

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
6601587	Male infertility			62 (20 normal men and 42 patients with infertility)	Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881