• Gene id: 79791

Gene Summary

• Gene Symbol: FBXO31   Gene   UCSC   Ensembl
• Aliases: FBX14, FBXO14, Fbx31, MRT45, pp2386
• Gene name: F-box protein 31
• Alternate names: F-box only protein 31, SCF ubiquitin ligase specificity factor, putative breast cancer tumor-suppressor,
• Gene location: 16q24.2 (87392120: 87326986)     Exons: 11     NC_000016.10
• Gene summary(Entrez): This gene is a member of the F-box family. Members are classified into three classes according to the substrate interaction domain, FBW for WD40 repeats, FBL for leucing-rich repeats, and FBXO for other domains. This protein, classified into the last cate
• OMIM: 617042

Protein Summary

• Protein general information: Q5XUX0  
  • Name: F box only protein 31
  • Length: 539  
  • Mass: 60664
  • Tissue specificity: Highly expressed in brain. Expressed at moderate levels in most tissues, except bone marrow. {ECO
• Sequence:

  MAVCARLCGVGPSRGCRRRQQRRGPAETAAADSEPDTDPEEERIEASAGVGGGLCAGPSPPPPRCSLLELPPELL
  VEIFASLPGTDLPSLAQVCTKFRRILHTDTIWRRRCREEYGVCENLRKLEITGVSCRDVYAKLLHRYRHILGLWQ
  PDIGPYGGLLNVVVDGLFIIGWMYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVKKDE
  FSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLI
  KPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRHRIQLPDLENQRNFNELSRIVLEVRE
  RVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPSKGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQPFVLPV
  GVSSRNEDYPRTCRMCFYGTGLIAGHGFTSPERTPGVFILFDEDRFGFVWLELKSFSLYSRVQATFRNADAPSPQ
  AFDEMLKNIQSLTS

• Structural information:
  • Protein Domains: (64..11-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR036047  IPR001810  IPR026941  
  • Prosite: PS50181
  • PDB: 5VZT 5VZU
  • PDBsum: 5VZT 5VZU
  • DIP: 60449
  • STRING: ENSP00000310841
• Other Databases: GeneCards:  FBXO31  Malacards:  FBXO31

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0031571	mitotic G1 DNA damage checkpoint	IMP	biological process
GO:0043025	neuronal cell body	ISS	cellular component
GO:0030332	cyclin binding	IPI	molecular function
GO:0031145	anaphase-promoting complex-dependent catabolic process	IMP	biological process
GO:0031571	mitotic G1 DNA damage checkpoint	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0019005	SCF ubiquitin ligase complex	IEA	cellular component
GO:0030332	cyclin binding	IEA	molecular function
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050775	positive regulation of dendrite morphogenesis	IEA	biological process
GO:0005813	centrosome	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:2001224	positive regulation of neuron migration	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Autosomal recessive mental retardation	KEGG:H00768
Autosomal recessive mental retardation	KEGG:H00768
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq