Gene id |
7979 |
Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed |
Gene Summary
|
Gene Symbol |
SEM1 Gene UCSC Ensembl |
Aliases |
C7orf76, DSS1, ECD, SHFD1, SHFM1, SHSF1, Shfdg1 |
Gene name |
SEM1 26S proteasome complex subunit |
Alternate names |
26S proteasome complex subunit SEM1, 26S proteasome complex subunit DSS1, deleted in split hand/split foot protein 1, deleted in split-hand/split-foot 1, split hand/foot deleted protein 1, split hand/foot malformation (ectrodactyly) type 1, split hand/foot malf, |
Gene location |
7q21.3 (31937006: 32001039) Exons: 16 NC_000017.11
|
Gene summary(Entrez) |
The product of this gene has been localized within the split hand/split foot malformation locus SHFM1 at chromosome 7. It has been proposed to be a candidate gene for the autosomal dominant form of the heterogeneous limb developmental disorder split hand/
|
OMIM |
601285 |
Protein Summary
|
Protein general information
| P60896
Name: 26S proteasome complex subunit SEM1 (26S proteasome complex subunit DSS1) (Deleted in split hand/split foot protein 1) (Split hand/foot deleted protein 1) (Split hand/foot malformation type 1 protein)
Length: 70 Mass: 8278
Tissue specificity: Expressed in limb bud, craniofacial primordia and skin.
|
Sequence |
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS
|
Structural information |
|
Other Databases |
GeneCards: SEM1  Malacards: SEM1 |
|
GO accession | Term name | Evidence code | Go category |
---|
|
|
|
|
Associated diseases |
References |
Aberrant CpGs in Low Motility Sperm | MIK: 21674046 |
Teratozoospermia | MIK: 17327269 |
|
|
PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
21674046 |
Aberrant C pGs in Low Motility Sperm
|
|
|
18
|
Male infertility |
GSE26881
|
Show abstract |
|