• Gene id: 79778

Gene Summary

• Gene Symbol: MICALL2   Gene   UCSC   Ensembl
• Aliases: JRAB, MICAL-L2
• Gene name: MICAL like 2
• Alternate names: MICAL-like protein 2, junctional Rab13-binding protein, molecule interacting with CasL-like 2,
• Gene location: 7p22.3 (1459496: 1433638)     Exons: 19     NC_000007.14
• OMIM: 609102

Protein Summary

• Protein general information: Q8IY33  
  • Name: MICAL like protein 2 (Junctional Rab13 binding protein) (Molecule interacting with CasL like 2) (MICAL L2)
  • Length: 904  
  • Mass: 97502
• Sequence:

  MAAIRALQQWCRQQCEGYRDVNICNMTTSFRDGLAFCAILHRHRPDLINFSALKKENIYENNKLAFRVAEEHLGI
  PALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRSPIGGMAGVKRASEDSEEEPSGKKAPVQAAKLPSPAPARKP
  PLSPAQTNPVVQRRNEGAGGPPPKTDQALAGSLVSSTCGVCGKHVHLVQRHLADGRLYHRSCFRCKQCSCTLHSG
  AYKATGEPGTFVCTSHLPAAASASPKLTGLVPRQPGAMGVDSRTSCSPQKAQEANKARPSAWEPAAGNSPARASV
  PAAPNPAATSATSVHVRSPARPSESRLAPTPTEGKVRPRVTNSSPMGWSSAAPCTAAAASHPAVPPSAPDPRPAT
  PQGGGAPRVAAPQTTLSSSSTSAATVDPPAWTPSASRTQQARNKFFQTSAVPPGTSLSGRGPTPSLVLSKDSSKE
  QARNFLKQALSALEEAGAPAPGRPSPATAAVPSSQPKTEAPQASPLAKPLQSSSPRVLGLPSRMEPPAPLSTSST
  SQASALPPAGRRNLAESSGVGRVGAGSRPKPEAPMAKGKSTTLTQDMSTSLQEGQEDGPAGWRANLKPVDRRSPA
  ERTLKPKEPRALAEPRAGEAPRKVSGSFAGSVHITLTPVRPDRTPRPASPGPSLPARSPSPPRRRRLAVPASLDV
  CDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERR
  LDALELRGVELEKRLRAAEGDDAEDSLMVDWFWLIHEKQLLLRQESELMYKSKAQRLEEQQLDIEGELRRLMAKP
  EALKSLQERRREQELLEQYVSTVNDRSDIVDSLDEDRLREQEEDQMLRDMIEKLGLQRKKSKFRLSKIWSPKSKS
  SPSQ

• Structural information:
  • Protein Domains: (1..10-)
    (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044-)
    (186..24-)
    (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (723..87-)
    (/note="bMERB-)
    (/evidence="ECO:0000255|PROS-)
  • Interpro: IPR022735  IPR001715  IPR036872  IPR028563  IPR001781  
  • Prosite: PS51848 PS50021 PS00478 PS50023
  • CDD: cd00014
  • STRING: ENSP00000297508
• Other Databases: GeneCards:  MICALL2  Malacards:  MICALL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903955	positive regulation of protein targeting to mitochondrion	HMP	biological process
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0031941	filamentous actin	IBA	cellular component
GO:0005815	microtubule organizing center	IBA	cellular component
GO:0031005	filamin binding	IDA	molecular function
GO:0055037	recycling endosome	ISS	cellular component
GO:0051015	actin filament binding	ISS	molecular function
GO:0043005	neuron projection	ISS	cellular component
GO:0032456	endocytic recycling	ISS	biological process
GO:0031175	neuron projection development	ISS	biological process
GO:0030041	actin filament polymerization	ISS	biological process
GO:0005923	bicellular tight junction	ISS	cellular component
GO:0005911	cell-cell junction	ISS	cellular component
GO:0070830	bicellular tight junction assembly	ISS	biological process
GO:0034446	substrate adhesion-dependent cell spreading	ISS	biological process
GO:0032432	actin filament bundle	ISS	colocalizes with
GO:0031532	actin cytoskeleton reorganization	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0001725	stress fiber	ISS	colocalizes with
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0032456	endocytic recycling	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070830	bicellular tight junction assembly	IEA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0032432	actin filament bundle	IEA	cellular component
GO:0031532	actin cytoskeleton reorganization	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0001725	stress fiber	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0031175	neuron projection development	IEA	biological process
GO:0030041	actin filament polymerization	IEA	biological process
GO:0055037	recycling endosome	IEA	cellular component
GO:0051015	actin filament binding	IEA	molecular function
GO:0042805	actinin binding	IEA	molecular function
GO:0032456	endocytic recycling	IEA	biological process
GO:0031175	neuron projection development	IEA	biological process
GO:0031005	filamin binding	IEA	molecular function
GO:0030041	actin filament polymerization	IEA	biological process
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq