• Gene id: 79777

Gene Summary

• Gene Symbol: ACBD4   Gene   UCSC   Ensembl
• Aliases: HMFT0700
• Gene name: acyl-CoA binding domain containing 4
• Alternate names: acyl-CoA-binding domain-containing protein 4, acyl-Coenzyme A binding domain containing 4,
• Gene location: 17q21.31 (45132599: 45144180)     Exons: 14     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent li
• OMIM: 609829

Protein Summary

• Protein general information: Q8NC06  
  • Name: Acyl CoA binding domain containing protein 4
  • Length: 268  
  • Mass: 30308
• Sequence:

  MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNS
  LGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVG
  AVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELSSGQHLEESVIPGTAPCPPQRKRGCGAARRGPRS
  WTCGCWGQFEHYRRACRRCRRGCRAWRACPGPLSSLTLSVRLE

• Structural information:
  • Protein Domains: (12..10-)
    (/note="ACB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00573"-)
  • Interpro: IPR022408  IPR000582  IPR035984  IPR014352  
  • Prosite: PS00880 PS51228
  • CDD: cd00435
  • PDB: 2WH5
  • PDBsum: 2WH5
• Other Databases: GeneCards:  ACBD4  Malacards:  ACBD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000062	fatty-acyl-CoA binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R