• Gene id: 7976

Gene Summary

• Gene Symbol: FZD3   Gene   UCSC   Ensembl
• Aliases: Fz-3
• Gene name: frizzled class receptor 3
• Alternate names: frizzled-3, frizzled 3, seven transmembrane spanning receptor, frizzled family receptor 3, frizzled homolog 3,
• Gene location: 8p21.1 (176269422: 176338024)     Exons: 12     NC_000002.12
• Gene summary(Entrez): This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the be
• OMIM: 606143

Protein Summary

• Protein general information: Q9NPG1  
  • Name: Frizzled 3 (Fz 3) (hFz3)
  • Length: 666  
  • Mass: 76263
  • Tissue specificity: Widely expressed. Relatively high expression in the CNS, including regions of the limbic system, in kidney, pancreas, skeletal muscle, uterus and testis.
• Sequence:

  MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLDCSR
  DFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPT
  EGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFL
  IDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMILYFFTMAG
  SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGVCFVGLYDVDALRYFV
  LAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIRIGVFSILYLVPLLVVIGCYFYEQAYRGIWE
  TTWIQERCREYHIPCPYQVTQMSRPDLILFLMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQ
  VLQEPDFAQSLLRDPNTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPC
  SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIEEDGTSA

• Structural information:
  • Protein Domains: (23..13-)
    (/note="FZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00090"-)
  • Interpro: IPR015526  IPR000539  IPR020067  IPR036790  IPR041769   IPR026553  IPR017981  
  • Prosite: PS50038 PS50261
  • CDD: cd07449
  • STRING: ENSP00000437489
• Other Databases: GeneCards:  FZD3  Malacards:  FZD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042813	Wnt-activated receptor activity	NAS	molecular function
GO:1904693	midbrain morphogenesis	TAS	biological process
GO:0017147	Wnt-protein binding	NAS	molecular function
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	NAS	biological process
GO:0042813	Wnt-activated receptor activity	IBA	molecular function
GO:0060070	canonical Wnt signaling pathway	IBA	biological process
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:1900118	negative regulation of execution phase of apoptosis	ISS	biological process
GO:0061549	sympathetic ganglion development	ISS	biological process
GO:0045976	negative regulation of mitotic cell cycle, embryonic	ISS	biological process
GO:0002052	positive regulation of neuroblast proliferation	ISS	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0042813	Wnt-activated receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007223	Wnt signaling pathway, calcium modulating pathway	TAS	biological process
GO:0048786	presynaptic active zone	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0033278	cell proliferation in midbrain	IEA	biological process
GO:0030901	midbrain development	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0001843	neural tube closure	IEA	biological process
GO:0001736	establishment of planar polarity	IEA	biological process
GO:0051602	response to electrical stimulus	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:1904938	planar cell polarity pathway involved in axon guidance	IEA	biological process
GO:1900118	negative regulation of execution phase of apoptosis	IEA	biological process
GO:0071679	commissural neuron axon guidance	IEA	biological process
GO:0061549	sympathetic ganglion development	IEA	biological process
GO:0045976	negative regulation of mitotic cell cycle, embryonic	IEA	biological process
GO:0045177	apical part of cell	IEA	cellular component
GO:0042813	Wnt-activated receptor activity	IEA	molecular function
GO:0042472	inner ear morphogenesis	IEA	biological process
GO:0036515	serotonergic neuron axon guidance	IEA	biological process
GO:0036514	dopaminergic neuron axon guidance	IEA	biological process
GO:0036342	post-anal tail morphogenesis	IEA	biological process
GO:0032433	filopodium tip	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0016328	lateral plasma membrane	IEA	cellular component
GO:0002052	positive regulation of neuroblast proliferation	IEA	biological process
GO:0001942	hair follicle development	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0042813	Wnt-activated receptor activity	IC	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017147	Wnt-protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05206	MicroRNAs in cancer
hsa04360	Axon guidance
hsa05205	Proteoglycans in cancer
hsa04310	Wnt signaling pathway
hsa04150	mTOR signaling pathway
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04934	Cushing syndrome
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa04916	Melanogenesis
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Williams-Beuren syndrome	PMID:9147651
Schizophrenia	PMID:14642436
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R