• Gene id: 79752

Gene Summary

• Gene Symbol: ZFAND1   Gene   UCSC   Ensembl
• Gene name: zinc finger AN1-type containing 1
• Alternate names: AN1-type zinc finger protein 1, zinc finger AN1-type-containing protein 1, zinc finger, AN1-type domain 1,
• Gene location: 8q21.13 (64590809: 64603249)     Exons: 9     NC_000011.10

Protein Summary

• Protein general information: Q8TCF1  
  • Name: AN1 type zinc finger protein 1 (Zinc finger AN1 type containing protein 1)
  • Length: 268  
  • Mass: 30787
• Sequence:

  MAELDIGQHCQVEHCRQRDFLPFVCDDCSGIFCLEHRSRESHGCPEVTVINERLKTDQHTSYPCSFKDCAERELV
  AVICPYCEKNFCLRHRHQSDHECEKLEIPKPRMAATQKLVKDIIDSKTGETASKRWKGAKNSETAAKVALMKLKM
  HADGDKSLPQTERIYFQVFLPKGSKEKSKPMFFCHRWSIGKAIDFAASLARLKNDNNKFTAKKLRLCHITSGEAL
  PLDHTLETWIAKEDCPLYNGGNIILEYLNDEEQFCKNVESYLE

• Structural information:
  • Interpro: IPR035896  IPR000058  
  • Prosite: PS51039
  • STRING: ENSP00000220669
• Other Databases: GeneCards:  ZFAND1  Malacards:  ZFAND1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0070628	proteasome binding	IDA	molecular function
GO:0090316	positive regulation of intracellular protein transport	IMP	biological process
GO:0071470	cellular response to osmotic stress	IMP	NOT|biological process
GO:0034599	cellular response to oxidative stress	IMP	NOT|biological process
GO:0034605	cellular response to heat	IMP	NOT|biological process
GO:1903843	cellular response to arsenite ion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035617	stress granule disassembly	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0010494	cytoplasmic stress granule	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)