• Gene id: 79748

Gene Summary

• Gene Symbol: LMAN1L   Gene   UCSC   Ensembl
• Aliases: ERGIC-53L, ERGL
• Gene name: lectin, mannose binding 1 like
• Alternate names: protein ERGIC-53-like, ERGIC53-like protein, LMAN1-like protein,
• Gene location: 15q24.1 (74812834: 74825753)     Exons: 14     NC_000015.10
• Gene summary(Entrez): This gene encodes a mannose-binding type 1 transmembrane protein that contains an N-terminal lectin-like carbohydrate recognition domain. The encoded protein is similar in structure to lectins found in leguminous plants. This lectin is thought to transpor

Protein Summary

• Protein general information: Q9HAT1  
  • Name: Protein ERGIC 53 like (ERGIC53 like protein) (Lectin mannose binding 1 like) (LMAN1 like protein)
  • Length: 526  
  • Mass: 57129
  • Tissue specificity: Highly expressed in normal and neoplastic prostate. Also expressed in cardiac atrium, salivary gland, spleen and selective cells in the CNS. {ECO
• Sequence:

  MPAVSGPGPLFCLLLLLLDPHSPETGCPPLRRFEYKLSFKGPRLALPGAGIPFWSHHGDAILGLEEVRLTPSMRN
  RSGAVWSRASVPFSAWEVEVQMRVTGLGRRGAQGMAVWYTRGRGHVGSVLGGLASWDGIGIFFDSPAEDTQDSPA
  IRVLASDGHIPSEQPGDGASQGLGSCHWDFRNRPHPFRARITYWGQRLRMSLNSGLTPSDPGEFCVDVGPLLLVP
  GGFFGVSAATGTLADDHDVLSFLTFSLSEPSPEVPPQPFLEMQQLRLARQLEGLWARLGLGTREDVTPKSDSEAQ
  GEGERLFDLEETLGRHRRILQALRGLSKQLAQAERQWKKQLGPPGQARPDGGWALDASCQIPSTPGRGGHLSMSL
  NKDSAKVGALLHGQWTLLQALQEMRDAAVRMAAEAQVSYLPVGIEHHFLELDHILGLLQEELRGPAKAAAKAPRP
  PGQPPRASSCLQPGIFLFYLLIQTVGFFGYVHFRQELNKSLQECLSTGSLPLGPAPHTPRALGILRRQPLPASMP
  A

• Structural information:
  • Protein Domains: (31..25-)
    (/note="L-type-lectin-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00658"-)
  • Interpro: IPR013320  IPR005052  
  • Prosite: PS51328
  • STRING: ENSP00000310431
• Other Databases: GeneCards:  LMAN1L  Malacards:  LMAN1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0000139	Golgi membrane	IBA	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	IBA	cellular component
GO:0007030	Golgi organization	IBA	biological process
GO:0007029	endoplasmic reticulum organization	IBA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0005537	mannose binding	IBA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospadias	MIK: 22906644

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
22906644	Hypospadias	Methylation site (cg21948564)		20 (12 patients with isolated hypospadias and 8 healthy controls)	Male infertility	Microarray