• Gene id: 79727

Gene Summary

• Gene Symbol: LIN28A   Gene   UCSC   Ensembl
• Aliases: CSDD1, LIN-28, LIN28, ZCCHC1, lin-28A
• Gene name: lin-28 homolog A
• Alternate names: protein lin-28 homolog A, RNA-binding protein LIN-28, zinc finger CCHC domain-containing protein 1, zinc finger, CCHC domain containing 1,
• Gene location: 1p36.11 (26410777: 26429727)     Exons: 5     NC_000001.11
• Gene summary(Entrez): This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRN
• OMIM: 608780

Protein Summary

• Protein general information: Q9H9Z2  
  • Name: Protein lin 28 homolog A (Lin 28A) (Zinc finger CCHC domain containing protein 1)
  • Length: 209  
  • Mass: 22743
  • Tissue specificity: Expressed in embryonic stem cells, placenta and testis. Tends to be up-regulated in HER2-overexpressing breast tumors. {ECO
• Sequence:

  MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVH
  QSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAK
  ECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN

• Structural information:
  • Protein Domains: (39..11-)
    (/note="CSD"-)
  • Interpro: IPR011129  IPR002059  IPR012340  IPR001878  IPR036875  
  • Prosite: PS51857 PS50158
  • CDD: cd04458
  • PDB: 2CQF 2LI8 5UDZ
  • PDBsum: 2CQF 2LI8 5UDZ
  • STRING: ENSP00000363314
• Other Databases: GeneCards:  LIN28A  Malacards:  LIN28A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:1905538	polysome binding	IDA	molecular function
GO:0005844	polysome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:2000767	positive regulation of cytoplasmic translation	IMP	biological process
GO:1990825	sequence-specific mRNA binding	ISS	molecular function
GO:0035198	miRNA binding	ISS	molecular function
GO:0005791	rough endoplasmic reticulum	ISS	cellular component
GO:0017148	negative regulation of translation	ISS	biological process
GO:0002151	G-quadruplex RNA binding	ISS	molecular function
GO:0031123	RNA 3'-end processing	IMP	biological process
GO:0031123	RNA 3'-end processing	IMP	biological process
GO:0010587	miRNA catabolic process	IMP	biological process
GO:0010587	miRNA catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031054	pre-miRNA processing	IMP	biological process
GO:0031054	pre-miRNA processing	IMP	biological process
GO:0019827	stem cell population maintenance	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0035019	somatic stem cell population maintenance	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1990825	sequence-specific mRNA binding	IEA	molecular function
GO:0071333	cellular response to glucose stimulus	IEA	biological process
GO:0048863	stem cell differentiation	IEA	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0035198	miRNA binding	IEA	molecular function
GO:0032008	positive regulation of TOR signaling	IEA	biological process
GO:0031369	translation initiation factor binding	IEA	molecular function
GO:0017148	negative regulation of translation	IEA	biological process
GO:0010587	miRNA catabolic process	IEA	biological process
GO:0010586	miRNA metabolic process	IEA	biological process
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0003729	mRNA binding	IEA	molecular function
GO:0002151	G-quadruplex RNA binding	IEA	molecular function
GO:1903800	positive regulation of production of miRNAs involved in gene silencing by miRNA	IEA	biological process
GO:1901724	positive regulation of cell proliferation involved in kidney development	IEA	biological process
GO:0071076	RNA 3' uridylation	IEA	biological process
GO:0060964	regulation of gene silencing by miRNA	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0045686	negative regulation of glial cell differentiation	IEA	biological process
GO:0031054	pre-miRNA processing	IEA	biological process
GO:0007281	germ cell development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0032008	positive regulation of TOR signaling	ISS	biological process
GO:0071333	cellular response to glucose stimulus	ISS	biological process
GO:0051897	positive regulation of protein kinase B signaling	ISS	biological process
GO:1903800	positive regulation of production of miRNAs involved in gene silencing by miRNA	ISS	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray