• Gene id: 79723

Gene Summary

• Gene Symbol: SUV39H2   Gene   UCSC   Ensembl
• Aliases: KMT1B
• Gene name: suppressor of variegation 3-9 homolog 2
• Alternate names: histone-lysine N-methyltransferase SUV39H2, H3-K9-HMTase 2, histone H3-K9 methyltransferase 2, lysine N-methyltransferase 1B, su(var)3-9 homolog 2,
• Gene location: 10p13 (14878782: 14904314)     Exons: 8     NC_000010.11
• OMIM: 606503

Protein Summary

• Protein general information: Q9H5I1  
  • Name: Histone lysine N methyltransferase SUV39H2 (EC 2.1.1.355) (Histone H3 K9 methyltransferase 2) (H3 K9 HMTase 2) (Lysine N methyltransferase 1B) (Suppressor of variegation 3 9 homolog 2) (Su(var)3 9 homolog 2)
  • Length: 410  
  • Mass: 46682
• Sequence:

  MAAVGAEARGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKDMEYYLVKWKGWPDST
  NTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLKPAIAEYIVKKAKQRIALQRWQDELNRRKNH
  KGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTP
  IYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
  GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMK
  GSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN

• Structural information:
  • Protein Domains: (47..10-)
    (/note="Chromo-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00053-)
    (189..24-)
    (/note="Pre-SET-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00157-)
    (250..37-)
    (/note="SET-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00190-)
    (-)
  • Interpro: IPR016197  IPR000953  IPR023780  IPR023779  IPR011381   IPR003616  IPR007728  IPR001214  
  • Prosite: PS00598 PS50013 PS50868 PS50867 PS51579 PS50280
  • PDB: 2R3A 6P0R
  • PDBsum: 2R3A 6P0R
  • STRING: ENSP00000346997
• Other Databases: GeneCards:  SUV39H2  Malacards:  SUV39H2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046974	histone methyltransferase activity (H3-K9 specific)	IBA	molecular function
GO:0034968	histone lysine methylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0008270	zinc ion binding	IDA	molecular function
GO:1904047	S-adenosyl-L-methionine binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0042754	negative regulation of circadian rhythm	ISS	biological process
GO:0036124	histone H3-K9 trimethylation	ISS	biological process
GO:0036123	histone H3-K9 dimethylation	ISS	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0018024	histone-lysine N-methyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0034968	histone lysine methylation	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0071456	cellular response to hypoxia	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0046974	histone methyltransferase activity (H3-K9 specific)	IDA	molecular function
GO:0000785	chromatin	IDA	cellular component
GO:0006338	chromatin remodeling	IDA	biological process
GO:0006333	chromatin assembly or disassembly	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00310	Lysine degradation

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R