• Gene id: 79707

Gene Summary

• Gene Symbol: NOL9   Gene   UCSC   Ensembl
• Aliases: Grc3, NET6
• Gene name: nucleolar protein 9
• Alternate names: polynucleotide 5'-hydroxyl-kinase NOL9, polynucleotide 5'-kinase,
• Gene location: 1p36.31 (37073157: 37065363)     Exons: 7     NC_000021.9

Protein Summary

• Protein general information: Q5SY16  
  • Name: Polynucleotide 5' hydroxyl kinase NOL9 (EC 2.7.1. ) (Nucleolar protein 9)
  • Length: 702  
  • Mass: 79323
• Sequence:

  MADSGLLLKRGSCRSTWLRVRKARPQLILSRRPRRRLGSLRWCGRRRLRWRLLQAQASGVDWREGARQVSRAAAA
  RRPNTATPSPIPSPTPASEPESEPELESASSCHRPLLIPPVRPVGPGRALLLLPVEQGFTFSGICRVTCLYGQVQ
  VFGFTISQGQPAQDIFSVYTHSCLSIHALHYSQPEKSKKELKREARNLLKSHLNLDDRRWSMQNFSPQCSIVLLE
  HLKTATVNFITSYPGSSYIFVQESPTPQIKPEYLALRSVGIRREKKRKGLQLTESTLSALEELVNVSCEEVDGCP
  VILVCGSQDVGKSTFNRYLINHLLNSLPCVDYLECDLGQTEFTPPGCISLLNITEPVLGPPFTHLRTPQKMVYYG
  KPSCKNNYENYIDIVKYVFSAYKRESPLIVNTMGWVSDQGLLLLIDLIRLLSPSHVVQFRSDHSKYMPDLTPQYV
  DDMDGLYTKSKTKMRNRRFRLAAFADALEFADEEKESPVEFTGHKLIGVYTDFAFRITPRNRESHNKILRDLSIL
  SYLSQLQPPMPKPLSPLHSLTPYQVPFNAVALRITHSDVAPTHILYAVNASWVGLCKIQDDVRGYTNGPILLAQT
  PICDCLGFGICRGIDMEKRLYHILTPVPPEELRTVNCLLVGAIAIPHCVLKCQRGIEGTVPYVTTDYNFKLPGAS
  EKIGAREPEEAHKEKPYRRPKFCRKMK

• Structural information:
  • Interpro: IPR032319  
  • STRING: ENSP00000366934
• Other Databases: GeneCards:  NOL9  Malacards:  NOL9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0006396	RNA processing	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0051731	polynucleotide 5'-hydroxyl-kinase activity	IBA	molecular function
GO:0051731	polynucleotide 5'-hydroxyl-kinase activity	IDA	molecular function
GO:0005730	nucleolus	TAS	cellular component
GO:0000460	maturation of 5.8S rRNA	IMP	biological process
GO:0005524	ATP binding	TAS	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006364	rRNA processing	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045111	intermediate filament cytoskeleton	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray