• Gene id: 79697

Gene Summary

• Gene Symbol: RIOX1   Gene   UCSC   Ensembl
• Aliases: C14orf169, JMJD9, MAPJD, NO66, ROX, URLC2, hsNO66
• Gene name: ribosomal oxygenase 1
• Alternate names: ribosomal oxygenase 1, 60S ribosomal protein L8 histidine hydroxylase, MYC-associated protein with JmjC domain, bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66, histone lysine demethylase NO66, lysine-specific demethylase NO66, nucleolar ,
• Gene location: 14q24.3 (3480524: 3473985)     Exons: 4     NC_000019.10
• OMIM: 611919

Protein Summary

• Protein general information: Q9H6W3  
  • Name: Ribosomal oxygenase 1 (60S ribosomal protein L8 histidine hydroxylase) (Bifunctional lysine specific demethylase and histidyl hydroxylase NO66) (EC 1.14.11. ) (EC 1.14.11.27) (Histone lysine demethylase NO66) (Myc associated protein with JmjC domain) (Nuc
  • Length: 641  
  • Mass: 71086
  • Tissue specificity: Widely expressed. Overexpressed in lung carcinomas. {ECO
• Sequence:

  MDGLQASAGPLRRGRPKRRRKPQPHSGSVLALPLRSRKIRKQLRSVVSRMAALRTQTLPSENSEESRVESTADDL
  GDALPGGAAVAAVPDAARREPYGHLGPAELLEASPAARSLQTPSARLVPASAPPARLVEVPAAPVRVVETSALLC
  TAQHLAAVQSSGAPATASGPQVDNTGGEPAWDSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFYRRLWER
  EAVLVRRQDHTYYQGLFSTADLDSMLRNEEVQFGQHLDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLC
  PQAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQLEGRKLWRVYRPRVPTEELALTSSP
  NFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTLSTYQRNTWGDFLEAILPLAVQAAMEENVEF
  RRGLPRDFMDYMGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVYG
  LPIRWEAGEPVNVGAQLTTETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLG
  SYPEFVRVGDLPCDSVEDQLSLATTLYDKGLLLTKMPLALN

• Structural information:
  • Protein Domains: (294..43-)
    (/note="JmjC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00538"-)
  • Interpro: IPR003347  IPR039994  
  • Prosite: PS51184
  • PDB: 4CCJ 4CCK 4CCM 4CCN 4CCO 4DIQ 4E4H 4Y33 4Y3O 4Y4R
  • PDBsum: 4CCJ 4CCK 4CCM 4CCN 4CCO 4DIQ 4E4H 4Y33 4Y3O 4Y4R
  • DIP: 53768
  • STRING: ENSP00000477507
• Other Databases: GeneCards:  RIOX1  Malacards:  RIOX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051864	histone demethylase activity (H3-K36 specific)	IBA	molecular function
GO:0032453	histone demethylase activity (H3-K4 specific)	IBA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0032453	histone demethylase activity (H3-K4 specific)	ISS	molecular function
GO:0016706	2-oxoglutarate-dependent dioxygenase activity	ISS	molecular function
GO:0005506	iron ion binding	ISS	molecular function
GO:0070544	histone H3-K36 demethylation	ISS	biological process
GO:0051864	histone demethylase activity (H3-K36 specific)	ISS	molecular function
GO:0045668	negative regulation of osteoblast differentiation	ISS	biological process
GO:0034720	histone H3-K4 demethylation	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0051864	histone demethylase activity (H3-K36 specific)	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0032453	histone demethylase activity (H3-K4 specific)	IEA	molecular function
GO:0016706	2-oxoglutarate-dependent dioxygenase activity	IEA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005506	iron ion binding	IEA	molecular function
GO:0070544	histone H3-K36 demethylation	IEA	biological process
GO:0051864	histone demethylase activity (H3-K36 specific)	IEA	molecular function
GO:0045668	negative regulation of osteoblast differentiation	IEA	biological process
GO:0034720	histone H3-K4 demethylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)