• Gene id: 79691

Gene Summary

• Gene Symbol: QTRT2   Gene   UCSC   Ensembl
• Aliases: QTRTD1
• Gene name: queuine tRNA-ribosyltransferase accessory subunit 2
• Alternate names: queuine tRNA-ribosyltransferase accessory subunit 2, queuine tRNA-ribosyltransferase domain containing 1,
• Gene location: 3q13.31 (75647686: 75627723)     Exons: 15     NC_000016.10
• Gene summary(Entrez): This gene encodes a subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code

Protein Summary

• Protein general information: Q9H974  
  • Name: Queuine tRNA ribosyltransferase accessory subunit 2 (Queuine tRNA ribosyltransferase domain containing protein 1)
  • Length: 415  
  • Mass: 46713
• Sequence:

  MKLSLTKVVNGCRLGKIKNLGKTGDHTMDIPGCLLYTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLT
  EYKEGVGKFIGMPESLLYCSLHDPVSPCPAGYVTNKSVSVWSVAGRVEMTVSKFMAIQKALQPDWFQCLSDGEVS
  CKEATSIKRVRKSVDRSLLFLDNCLRLQEESEVLQKSVIIGVIEGGDVMEERLRSARETAKRPVGGFLLDGFQGN
  PTTLEARLRLLSSVTAELPEDKPRLISGVSRPDEVLECIERGVDLFESFFPYQVTERGCALTFSFDYQPNPEETL
  LQQNGTQEEIKCMDQIKKIETTGCNQEITSFEINLKEKKYQEDFNPLVRGCSCYCCKNHTRAYIHHLLVTNELLA
  GVLLMMHNFEHYFGFFHYIREALKSDKLAQLKELIHRQAS

• Structural information:
  • Interpro: IPR028592  IPR036511  IPR002616  
  • STRING: ENSP00000420682
• Other Databases: GeneCards:  QTRT2  Malacards:  QTRT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0101030	tRNA-guanine transglycosylation	IBA	biological process
GO:0008479	queuine tRNA-ribosyltransferase activity	IC	contributes to
GO:0101030	tRNA-guanine transglycosylation	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0032991	protein-containing complex	IPI	cellular component
GO:0005739	mitochondrion	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0008479	queuine tRNA-ribosyltransferase activity	IEA	molecular function
GO:0006400	tRNA modification	IEA	biological process
GO:0016763	transferase activity, transferring pentosyl groups	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0006400	tRNA modification	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0008479	queuine tRNA-ribosyltransferase activity	IEA	molecular function
GO:0101030	tRNA-guanine transglycosylation	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)