• Gene id: 79690

Gene Summary

• Gene Symbol: GAL3ST4   Gene   UCSC   Ensembl
• Aliases: GAL3ST-4
• Gene name: galactose-3-O-sulfotransferase 4
• Alternate names: galactose-3-O-sulfotransferase 4, beta-galactose-3-O-sulfotransferase 4, gal-beta-1,3-GalNAc 3'-sulfotransferase,
• Gene location: 7q22.1 (100168616: 100159243)     Exons: 4     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the galactose-3-O-sulfotransferase protein family. The product of this gene catalyzes sulfonation by transferring a sulfate to the C-3' position of galactose residues in O-linked glycoproteins. This enzyme is highly specific
• OMIM: 612708

Protein Summary

• Protein general information: Q96RP7  
  • Name: Galactose 3 O sulfotransferase 4 (Gal3ST 4) (EC 2.8.2. ) (Beta galactose 3 O sulfotransferase 4) (Gal beta 1,3 GalNAc 3' sulfotransferase)
  • Length: 486  
  • Mass: 54166
  • Tissue specificity: Expressed mainly in placenta, thymus, testis, ovary, spinal cord, trachea and adrenal gland and at low levels in brain, lung, spleen, prostate, small intestine, colon, stomach thyroid and lymph node. {ECO
• Sequence:

  MGPLSPARTLRLWGPRSLGVALGVFMTIGFALQLLGGPFQRRLPGLQLRQPSAPSLRPALPSCPPRQRLVFLKTH
  KSGSSSVLSLLHRYGDQHGLRFALPARYQFGYPKLFQASRVKGYRPQGGGTQLPFHILCHHMRFNLKEVLQVMPS
  DSFFFSIVRDPAALARSAFSYYKSTSSAFRKSPSLAAFLANPRGFYRPGARGDHYARNLLWFDFGLPFPPEKRAK
  RGNIHPPRDPNPPQLQVLPSGAGPRAQTLNPNALIHPVSTVTDHRSQISSPASFDLGSSSFIQWGLAWLDSVFDL
  VMVAEYFDESLVLLADALCWGLDDVVGFMHNAQAGHKQGLSTVSNSGLTAEDRQLTARARAWNNLDWALYVHFNR
  SLWARIEKYGQGRLQTAVAELRARREALAKHCLVGGEASDPKYITDRRFRPFQFGSAKVLGYILRSGLSPQDQEE
  CERLATPELQYKDKLDAKQFPPTVSLPLKTSRPLSP

• Structural information:
  • Interpro: IPR009729  IPR027417  
  • STRING: ENSP00000353142
• Other Databases: GeneCards:  GAL3ST4  Malacards:  GAL3ST4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050694	galactose 3-O-sulfotransferase activity	IBA	molecular function
GO:0009101	glycoprotein biosynthetic process	IBA	biological process
GO:0008146	sulfotransferase activity	IBA	molecular function
GO:0001733	galactosylceramide sulfotransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0009247	glycolipid biosynthetic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050694	galactose 3-O-sulfotransferase activity	IDA	molecular function
GO:0009101	glycoprotein biosynthetic process	IDA	biological process
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0050694	galactose 3-O-sulfotransferase activity	IDA	molecular function
GO:0050656	3'-phosphoadenosine 5'-phosphosulfate binding	NAS	molecular function
GO:0030166	proteoglycan biosynthetic process	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050698	proteoglycan sulfotransferase activity	NAS	molecular function
GO:0007267	cell-cell signaling	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0009311	oligosaccharide metabolic process	NAS	biological process
GO:0006790	sulfur compound metabolic process	NAS	biological process
GO:0009100	glycoprotein metabolic process	NAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq