• Gene id: 79689

Gene Summary

• Gene Symbol: STEAP4   Gene   UCSC   Ensembl
• Aliases: STAMP2, SchLAH, TIARP, TNFAIP9
• Gene name: STEAP4 metalloreductase
• Alternate names: metalloreductase STEAP4, STEAP family member 4, seven chromosome locus associated with HCC, six transmembrane prostate protein 2, six-transmembrane epithelial antigen of prostate 4, sixTransMembrane protein of prostate 2, tumor necrosis factor, alpha-induced pr,
• Gene location: 7q21.12 (26124171: 26124689)     Exons: 1     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the STEAP (six transmembrane epithelial antigen of prostate) family, and resides in the golgi apparatus. It functions as a metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1
• OMIM: 611098

Protein Summary

• Protein general information: Q687X5  
  • Name: Metalloreductase STEAP4 (EC 1.16.1.9) (Six transmembrane epithelial antigen of prostate 4) (SixTransMembrane protein of prostate 2) (Tumor necrosis factor, alpha induced protein 9)
  • Length: 459  
  • Mass: 51981
  • Tissue specificity: Ubiquitous. Highly expressed in adipose tissue. Expressed in placenta, lung, heart and prostate. Detected at lower levels in liver, skeletal muscle, pancreas, testis and small intestine. Highly expressed in joints of patients with rheu
• Sequence:

  MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSG
  IIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAWALQSGALDAS
  RQVFVCGNDSKAKQRVMDIVRNLGLTPMDQGSLMAAKEIEKYPLQLFPMWRFPFYLSAVLCVFLFFYCVIRDVIY
  PYVYEKKDNTFRMAISIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFPDWLDHWMLCRKQLGLVALGF
  AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVALGILGFFLFVLLGITSLPSVSNAVN
  WREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAYVLGLIIPCTVLVIKFVLIMPCVDNTLTRIR
  QGWERNSKH

• Structural information:
  • Protein Domains: (247..39-)
    (/note="Ferric-oxidoreductase)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR013130  IPR036291  IPR028939  
  • PDB: 6HCY 6HD1
  • PDBsum: 6HCY 6HD1
  • STRING: ENSP00000369419
• Other Databases: GeneCards:  STEAP4  Malacards:  STEAP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0008823	cupric reductase activity	IBA	molecular function
GO:0015677	copper ion import	IBA	biological process
GO:0052851	ferric-chelate reductase (NADPH) activity	IBA	molecular function
GO:0005768	endosome	IBA	cellular component
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0020037	heme binding	IDA	molecular function
GO:0071949	FAD binding	IDA	molecular function
GO:0070207	protein homotrimerization	IDA	biological process
GO:0009055	electron transfer activity	IDA	molecular function
GO:0016021	integral component of membrane	IDA	cellular component
GO:0052851	ferric-chelate reductase (NADPH) activity	IDA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0052851	ferric-chelate reductase (NADPH) activity	IEA	molecular function
GO:0052851	ferric-chelate reductase (NADPH) activity	IEA	molecular function
GO:0015677	copper ion import	IEA	biological process
GO:0008823	cupric reductase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0022900	electron transport chain	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0045444	fat cell differentiation	ISS	biological process

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray