• Gene id: 79683

Gene Summary

• Gene Symbol: ZDHHC14   Gene   UCSC   Ensembl
• Aliases: NEW1CP
• Gene name: zinc finger DHHC-type palmitoyltransferase 14
• Alternate names: probable palmitoyltransferase ZDHHC14, DHHC-14, NEW1 domain-containing protein, zinc finger DHHC domain-containing protein 14, zinc finger DHHC-type containing 14, zinc finger, DHHC domain containing 14,
• Gene location: 6q25.3 (157381189: 157678156)     Exons: 16     NC_000006.12

Protein Summary

• Protein general information: Q8IZN3  
  • Name: Probable palmitoyltransferase ZDHHC14 (EC 2.3.1.225) (NEW1 domain containing protein) (NEW1CP) (Zinc finger DHHC domain containing protein 14) (DHHC 14)
  • Length: 488  
  • Mass: 53388
• Sequence:

  MPPGGGGPMKDCEYSQISTHSSSPMESPHKKKKIAARRKWEVFPGRNKFFCNGRIMMARQTGVFYLTLVLILVTS
  GLFFAFDCPYLAVKITPAIPAVAGILFFFVMGTLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPP
  RTKEVIINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGKRNYRFFYMFILSLSFLTVFIF
  AFVITHVILRSQQTGFLNALKDSPASVLEAVVCFFSVWSIVGLSGFHTYLISSNQTTNEDIKGSWSNKRGKENYN
  PYSYGNIFTNCCVALCGPISPSLIDRRGYIQPDTPQPAAPSNGITMYGATQSQSDMCDQDQCIQSTKFVLQAAAT
  PLLQSEPSLTSDELHLPGKPGLGTPCASLTLGPPTPPASMPNLAEATLADVMPRKDEHMGHQFLTPDEAPSPPRL
  LAAGSPLAHSRTMHVLGLASQDSLHEDSVRGLVKLSSV

• Structural information:
  • Protein Domains: (165..21-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • STRING: ENSP00000352821
• Other Databases: GeneCards:  ZDHHC14  Malacards:  ZDHHC14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq