• Gene id: 79680

Gene Summary

• Gene Symbol: RTL10   Gene   UCSC   Ensembl
• Aliases: BOP, C22orf29
• Gene name: retrotransposon Gag like 10
• Alternate names: protein Bop, BH3-only protein, retrotransposon Gag-like protein 10,
• Gene location: 22q11.21 (19854873: 19846145)     Exons: 3     NC_000022.11

Protein Summary

• Protein general information: Q7L3V2  
  • Name: Protein Bop (BH3 only protein) (Retrotransposon Gag like protein 10)
  • Length: 364  
  • Mass: 39299
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MPRGRCRQQGPRIPIWAAANYANAHPWQQMDKASPGVAYTPLVDPWIERPCCGDTVCVRTTMEQKSTASGTCGGK
  PAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVCEILRRLTGRA
  QAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCPLPLASSQLPVAPQLPVVRQYLARFLEGLAL
  DMGTAPRSLPAAMATPAVSGSNSVSRSALFEQQLTKESTPGPKEPPVLPSSTCSSKPGPVEPASSQPEEAAPTPV
  PRLSESANPPAQRPDPAHPGGPKPQKTEEEVLETEGDQEVSLGTPQEVVEAPETPGEPPLSPGF

• Structural information:
  • Interpro: IPR031298  IPR032549  IPR032567  
  • STRING: ENSP00000384924
• Other Databases: GeneCards:  RTL10  Malacards:  RTL10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0051881	regulation of mitochondrial membrane potential	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IEA	biological process
GO:0097345	mitochondrial outer membrane permeabilization	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0097345	mitochondrial outer membrane permeabilization	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq