• Gene id: 79679

Gene Summary

• Gene Symbol: VTCN1   Gene   UCSC   Ensembl
• Aliases: B7-H4, B7H4, B7S1, B7X, B7h.5, PRO1291, VCTN1
• Gene name: V-set domain containing T cell activation inhibitor 1
• Alternate names: V-set domain-containing T-cell activation inhibitor 1, B7 family member, H4, B7 homolog 4, B7 superfamily member 1, T cell costimulatory molecule B7x, immune costimulatory protein B7-H4,
• Gene location: 1p13.1-p12 (117210984: 117143586)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that hig
• OMIM: 614108

Protein Summary

• Protein general information: Q7Z7D3  
  • Name: V set domain containing T cell activation inhibitor 1 (B7 homolog 4) (B7 H4) (B7h.5) (Immune costimulatory protein B7 H4) (Protein B7S1) (T cell costimulatory molecule B7x)
  • Length: 282  
  • Mass: 30878
  • Tissue specificity: Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level).
• Sequence:

  MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEG
  VLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAF
  SMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSC
  MIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK

• Structural information:
  • Protein Domains: (35..14-)
    1 (/note="Ig-like-V-type)
    (/evidence="ECO:0000255-)
    (153..24-)
    2 (/note="Ig-like-V-type)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • PDB: 4GOS
  • PDBsum: 4GOS
  • STRING: ENSP00000358470
• Other Databases: GeneCards:  VTCN1  Malacards:  VTCN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050776	regulation of immune response	IBA	biological process
GO:0001817	regulation of cytokine production	IBA	biological process
GO:0050852	T cell receptor signaling pathway	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0001562	response to protozoan	IEA	biological process
GO:0072602	interleukin-4 secretion	IEA	biological process
GO:0072643	interferon-gamma secretion	IEA	biological process
GO:1900042	positive regulation of interleukin-2 secretion	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0050868	negative regulation of T cell activation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0050868	negative regulation of T cell activation	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0042130	negative regulation of T cell proliferation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray