• Gene id: 79676

Gene Summary

• Gene Symbol: OGFOD2   Gene   UCSC   Ensembl
• Gene name: 2-oxoglutarate and iron dependent oxygenase domain containing 2
• Alternate names: 2-oxoglutarate and iron-dependent oxygenase domain-containing protein 2,
• Gene location: 12q24.31 (122974725: 122980041)     Exons: 10     NC_000012.12
• OMIM: 617531

Protein Summary

• Protein general information: Q6N063  
  • Name: 2 oxoglutarate and iron dependent oxygenase domain containing protein 2 (EC 1.14.11. )
  • Length: 350  
  • Mass: 38996
• Sequence:

  MATVGAPRHFCRCACFCTDNLYVARYGLHVRFRGEQQLRRDYGPILRSRGCVSAKDFQQLLAELEQEVERRQRLG
  QESAARKALIASSYHPARPEVYDSLQDAALAPEFLAVTEYSVSPDADLKGLLQRLETVSEEKRIYRVPVFTAPFC
  QALLEELEHFEQSDMPKGRPNTMNNYGVLLHELGLDEPLMTPLRERFLQPLMALLYPDCGGGRLDSHRAFVVKYA
  PGQDLELGCHYDNAELTLNVALGKVFTGGALYFGGLFQAPTALTEPLEVEHVVGQGVLHRGGQLHGARPLGTGER
  WNLVVWLRASAVRNSLCPMCCREPDLVDDEGFGDGFTREEPATVDVCALT

• Structural information:
  • Protein Domains: (215..30-)
    (/note="Fe2OG-dioxygenase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00805"-)
  • Interpro: IPR005123  IPR006620  
  • Prosite: PS51471
  • STRING: ENSP00000380544
• Other Databases: GeneCards:  OGFOD2  Malacards:  OGFOD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005506	iron ion binding	IEA	molecular function
GO:0031418	L-ascorbic acid binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0031418	L-ascorbic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0051213	dioxygenase activity	IEA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Male infertility, Embryo quality	MIK: 26361204

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
26361204	Male infertility, Embryo quality			181 (127 men undergoing IVF treatment, 54 normozoospermic, fertile men)	Male infertility	Microarray