• Gene id: 79672

Gene Summary

• Gene Symbol: FN3KRP   Gene   UCSC   Ensembl
• Aliases: FN3KL
• Gene name: fructosamine 3 kinase related protein
• Alternate names: ketosamine-3-kinase, FN3K-related protein, protein-psicosamine 3-kinase FN3KRP, testis secretory sperm-binding protein Li 211a,
• Gene location: 17q25.3 (212035552: 212105012)     Exons: 16     NC_000001.11
• Gene summary(Entrez): A high concentration of glucose can result in non-enzymatic oxidation of proteins by reaction of glucose and lysine residues (glycation). Proteins modified in this way are less active or functional. This gene encodes an enzyme which catalyzes the phosphor
• OMIM: 611683

Protein Summary

• Protein general information: Q9HA64  
  • Name: Ketosamine 3 kinase (EC 2.7.1.172) (Fructosamine 3 kinase related protein) (FN3K RP) (FN3K related protein) (Protein psicosamine 3 kinase FN3KRP) (EC 2.7.1. )
  • Length: 309  
  • Mass: 34412
  • Tissue specificity: Widely expressed; except in skeletal muscle where it is expressed at very low level (PubMed
• Sequence:

  MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARRMFEGEMASLTAILKTNTVKVPKPIK
  VLDAPGGGSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEMRLKEAGTVGRGGGQEERPFVARFGFDVVTC
  CGYLPQVNDWQEDWVVFYARQRIQPQMDMVEKESGDREALQLWSALQLKIPDLFRDLEIIPALLHGDLWGGNVAE
  DSSGPVIFDPASFYGHSEYELAIAGMFGGFSSSFYSAYHGKIPKAPGFEKRLQLYQLFHYLNHWNHFGSGYRGSS
  LNIMRNLVK

• Structural information:
  • Interpro: IPR016477  IPR011009  
  • STRING: ENSP00000269373
• Other Databases: GeneCards:  FN3KRP  Malacards:  FN3KRP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016301	kinase activity	IBA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0102193	protein-ribulosamine 3-kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0016301	kinase activity	TAS	molecular function
GO:0043687	post-translational protein modification	TAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq