• Gene id: 79671

Gene Summary

• Gene Symbol: NLRX1   Gene   UCSC   Ensembl
• Aliases: CLR11.3, DLNB26, NOD26, NOD5, NOD9
• Gene name: NLR family member X1
• Alternate names: NLR family member X1, NOD-like receptor X1, caterpiller protein 11.3, nucleotide-binding oligomerization domain protein 26, nucleotide-binding oligomerization domain protein 5, nucleotide-binding oligomerization domain protein 9, nucleotide-binding oligomerizat,
• Gene location: 11q23.3 (119168333: 119184015)     Exons: 13     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the NLR family and localizes to the outer mitochondrial membrane. The encoded protein is a regulator of mitochondrial antivirus responses. Three transcript variants encoding the same protein have been found
• OMIM: 611947

Protein Summary

• Protein general information: Q86UT6  
  • Name: NLR family member X1 (Caterpiller protein 11.3) (CLR11.3) (Nucleotide binding oligomerization domain protein 26) (Nucleotide binding oligomerization domain protein 5) (Nucleotide binding oligomerization domain protein 9)
  • Length: 975  
  • Mass: 107616
  • Tissue specificity: Ubiquitously expressed. Strongest expression in mammary gland, heart and muscle. Detected in HeLa, HEK293T, THP-1, HL-60, Raji and Jurkat cell lines (at protein level). {ECO
• Sequence:

  MRWGHHLPRASWGSGFRRALQRPDDRIPFLIHWSWPLQGERPFGPPRAFIRHHGSSVDSAPPPGRHGRLFPSASA
  TEAIQRHRRNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESTPDELLRPPAELALEHQPPQAGLPPLALSQLF
  NPDACGRRVQTVVLYGTVGTGKSTLVRKMVLDWCYGRLPAFELLIPFSCEDLSSLGPAPASLCQLVAQRYTPLKE
  VLPLMAAAGSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQASILVTTRPSAIGRIPS
  KYVGRYGEICGFSDTNLQKLYFQLRLNQPYCGYAVGGSGVSATPAQRDHLVQMLSRNLEGHHQIAAACFLPSYCW
  LVCATLHFLHAPTPAGQTLTSIYTSFLRLNFSGETLDSTDPSNLSLMAYAARTMGKLAYEGVSSRKTYFSEEDVC
  GCLEAGIRTEEEFQLLHIFRRDALRFFLAPCVEPGRAGTFVFTVPAMQEYLAALYIVLGLRKTTLQKVGKEVAEL
  VGRVGEDVSLVLGIMAKLLPLRALPLLFNLIKVVPRVFGRMVGKSREAVAQAMVLEMFREEDYYNDDVLDQMGAS
  ILGVEGPRRHPDEPPEDEVFELFPMFMGGLLSAHNRAVLAQLGCPIKNLDALENAQAIKKKLGKLGRQVLPPSEL
  LDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVLGSGRHALDEVNLASCQLDPAGLRTLLPVFL
  RARKLGLQLNSLGPEACKDLRDLLLHDQCQITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLE
  LLAAQLDRNRQLQELNVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSL
  TEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVEGEVRALLEQLGSSGS

• Structural information:
  • Protein Domains: (160..48-)
    (/note="NACHT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00136-)
    (667..69-)
    (/note="LRRNT-)
    (906..97-)
    (/note="LRRCT"-)
  • Interpro: IPR001611  IPR032675  IPR007111  
  • Prosite: PS50837
  • PDB: 3UN9
  • PDBsum: 3UN9
  • DIP: 60637
  • STRING: ENSP00000387334
• Other Databases: GeneCards:  NLRX1  Malacards:  NLRX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0032480	negative regulation of type I interferon production	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0039536	negative regulation of RIG-I signaling pathway	IEA	biological process
GO:0032715	negative regulation of interleukin-6 production	IEA	biological process
GO:0032688	negative regulation of interferon-beta production	IEA	biological process
GO:0045824	negative regulation of innate immune response	IEA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04621	NOD-like receptor signaling pathway
hsa05164	Influenza A
hsa04622	RIG-I-like receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881