• Gene id: 79661

Gene Summary

• Gene Symbol: NEIL1   Gene   UCSC   Ensembl
• Aliases: FPG1, NEI1, hFPG1
• Gene name: nei like DNA glycosylase 1
• Alternate names: endonuclease 8-like 1, DNA endonuclease eight-like glycosylase 1, DNA glycosylase/AP lyase Neil1, DNA-(apurinic or apyrimidinic site) lyase Neil1, NEH1, endonuclease VIII, endonuclease VIII-like 1, nei endonuclease VIII-like 1, nei homolog 1, nei-like protein 1,
• Gene location: 15q24.2 (75346637: 75357114)     Exons: 11     NC_000015.10
• Gene summary(Entrez): This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Mul
• OMIM: 608844

Protein Summary

• Protein general information: Q96FI4  
  • Name: Endonuclease 8 like 1 (EC 3.2.2. ) (EC 4.2.99.18) (DNA glycosylase/AP lyase Neil1) (DNA (apurinic or apyrimidinic site) lyase Neil1) (Endonuclease VIII like 1) (FPG1) (Nei homolog 1) (NEH1) (Nei like protein 1)
  • Length: 390  
  • Mass: 43684
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQEPLAL
  VFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQEYQQFRENVLR
  NLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQQHRPSPELTLSQKIRTKLQNPDL
  LELCHSVPKEVVQLGGKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSRKKKS
  KATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPEAPTVPKKGRRKGRQAASGHCRPRKV
  KADIPSLEPEGTSAS

• Structural information:
  • Interpro: IPR015886  IPR015371  IPR012319  IPR035937  IPR010979  
  • Prosite: PS51068
  • PDB: 1TDH 4NRV 5ITQ 5ITR 5ITT 5ITU 5ITX 5ITY
  • PDBsum: 1TDH 4NRV 5ITQ 5ITR 5ITT 5ITU 5ITX 5ITY
  • STRING: ENSP00000347170
• Other Databases: GeneCards:  NEIL1  Malacards:  NEIL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019104	DNA N-glycosylase activity	IBA	molecular function
GO:0006284	base-excision repair	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003906	DNA-(apurinic or apyrimidinic site) endonuclease activity	IBA	molecular function
GO:0006284	base-excision repair	IEA	biological process
GO:0006289	nucleotide-excision repair	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016799	hydrolase activity, hydrolyzing N-glycosyl compounds	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003684	damaged DNA binding	IEA	molecular function
GO:0003906	DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0140078	class I DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA	molecular function
GO:0003906	DNA-(apurinic or apyrimidinic site) endonuclease activity	TAS	molecular function
GO:0045008	depyrimidination	TAS	biological process
GO:0045008	depyrimidination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0019104	DNA N-glycosylase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0032074	negative regulation of nuclease activity	IDA	biological process
GO:0006979	response to oxidative stress	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0016798	hydrolase activity, acting on glycosyl bonds	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0006284	base-excision repair	IDA	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03410	Base excision repair

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)