• Gene id: 79660

Gene Summary

• Gene Symbol: PPP1R3B   Gene   UCSC   Ensembl
• Aliases: GL, PPP1R4, PTG
• Gene name: protein phosphatase 1 regulatory subunit 3B
• Alternate names: protein phosphatase 1 regulatory subunit 3B, PP1 subunit R4, hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL, hepatic glycogen-targeting subunit, G(L), protein phosphatase 1 regulatory subunit 4, protein phosphatase 1, regulatory (inhibi,
• Gene location: 8p23.1 (9151585: 9136254)     Exons: 3     NC_000008.11
• Gene summary(Entrez): This gene encodes the catalytic subunit of the serine/theonine phosphatase, protein phosphatase-1. The encoded protein is expressed in liver and skeletal muscle tissue and may be involved in regulating glycogen synthesis in these tissues. This gene may be
• OMIM: 610541

Protein Summary

• Protein general information: Q86XI6  
  • Name: Protein phosphatase 1 regulatory subunit 3B (Hepatic glycogen targeting protein phosphatase 1 regulatory subunit GL) (Protein phosphatase 1 regulatory subunit 4) (PP1 subunit R4) (Protein phosphatase 1 subunit GL) (PTG)
  • Length: 285  
  • Mass: 32695
  • Tissue specificity: Highly expressed in the liver and, at lower levels, in skeletal muscle, including in vastus lateralis, gastrocnemius and soleus (at protein level). Highest mRNA levels are observed in skeletal muscle, and only moderate levels in liver
• Sequence:

  MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTM
  VKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVK
  VQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSN
  RGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY

• Structural information:
  • Protein Domains: (125..23-)
    (/note="CBM21-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00491"-)
  • Interpro: IPR005036  IPR038175  IPR017434  IPR030682  
  • Prosite: PS51159
  • PDB: 2EEF 5ZT0
  • PDBsum: 2EEF 5ZT0
  • STRING: ENSP00000308318
• Other Databases: GeneCards:  PPP1R3B  Malacards:  PPP1R3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001069	glycogen binding	IBA	molecular function
GO:0008157	protein phosphatase 1 binding	IBA	molecular function
GO:0005979	regulation of glycogen biosynthetic process	IBA	biological process
GO:0000164	protein phosphatase type 1 complex	IBA	cellular component
GO:0000164	protein phosphatase type 1 complex	IEA	cellular component
GO:0005981	regulation of glycogen catabolic process	IEA	biological process
GO:0019888	protein phosphatase regulator activity	IEA	molecular function
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005981	regulation of glycogen catabolic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019899	enzyme binding	IEA	molecular function
GO:0019888	protein phosphatase regulator activity	IEA	molecular function
GO:0005981	regulation of glycogen catabolic process	IEA	biological process
GO:0050196	[phosphorylase] phosphatase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0042587	glycogen granule	IEA	cellular component
GO:0005979	regulation of glycogen biosynthetic process	IEA	biological process
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0000164	protein phosphatase type 1 complex	IEA	cellular component
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04910	Insulin signaling pathway
hsa04931	Insulin resistance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq