Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 7965
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol AIMP2   Gene   UCSC   Ensembl
Aliases HLD17, JTV-1, JTV1, P38
Gene name aminoacyl tRNA synthetase complex interacting multifunctional protein 2
Alternate names aminoacyl tRNA synthase complex-interacting multifunctional protein 2, ARS-interacting multi-functional protein 2, multisynthase complex auxiliary component p38, multisynthetase complex auxiliary component p38, protein JTV-1,
Gene location 7p22.1 (6009244: 6023833)     Exons: 9     NC_000007.14
Gene summary(Entrez) The protein encoded by this gene is part of the aminoacyl-tRNA synthetase complex, which contains nine different aminoacyl-tRNA synthetases and three non-enzymatic factors. The encoded protein is one of the non-enzymatic factors and is required for assemb
OMIM 600859

Protein Summary
Protein general information Q13155  

Name: Aminoacyl tRNA synthase complex interacting multifunctional protein 2 (Multisynthase complex auxiliary component p38) (Protein JTV 1)

Length: 320  Mass: 35349

Sequence MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDG
LSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLS
TVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKH
NAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQ
RWMRSCENLAPFNTALKLLK
Structural information
Protein Domains
 (220..31-)
(/note="GST-C-terminal")
Interpro:  IPR042360  IPR031889  IPR041503  IPR036282  IPR004046  

PDB:  		 4DPG 4YCU 4YCW 5A1N 5A34 5A5H 5Y6L 6ILD 6IY6 6JPV 6K39
PDBsum:   4DPG 4YCU 4YCW 5A1N 5A34 5A5H 5Y6L 6ILD 6IY6 6JPV 6K39

DIP:  
34421
MINT:  
STRING:   ENSP00000223029
Other Databases GeneCards:  AIMP2  Malacards:  AIMP2

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0017101 aminoacyl-tRNA synthetase
multienzyme complex
 IBA cellular component
GO:1903632 positive regulation of am
inoacyl-tRNA ligase activ
ity
 IBA biological process
GO:0005829 cytosol
 IDA cellular component
GO:0017101 aminoacyl-tRNA synthetase
multienzyme complex
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0017101 aminoacyl-tRNA synthetase
multienzyme complex
 IEA cellular component
GO:0006412 translation
 IEA biological process
GO:0030154 cell differentiation
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0007275 multicellular organism de
velopment
 IEA biological process
GO:0005737 cytoplasm
 IEA cellular component
GO:0006915 apoptotic process
 IEA biological process
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0006418 tRNA aminoacylation for p
rotein translation
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0017101 aminoacyl-tRNA synthetase
multienzyme complex
 IEA cellular component
GO:1903632 positive regulation of am
inoacyl-tRNA ligase activ
ity
 IEA biological process
GO:0060510 type II pneumocyte differ
entiation
 IEA biological process
GO:0017101 aminoacyl-tRNA synthetase
multienzyme complex
 IEA cellular component
GO:0008285 negative regulation of ce
ll population proliferati
on
 IEA biological process
GO:1901216 positive regulation of ne
uron death
 IEA biological process
GO:0065003 protein-containing comple
x assembly
 IEA biological process
GO:0060090 molecular adaptor activit
y
 IEA molecular function
GO:0031398 positive regulation of pr
otein ubiquitination
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0005829 cytosol
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0016020 membrane
 HDA cellular component
GO:0005515 protein binding
 IPI molecular function

Diseases

Expand All | Collapse All
Associated diseases References
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract
25753583 Unexplaine
d infertil
ity
46 (17 fertile
men, 29 male pa
tients)
 Male infertility Microarray
 Show abstract