• Gene id: 79626

Gene Summary

• Gene Symbol: TNFAIP8L2   Gene   UCSC   Ensembl
• Aliases: TIPE2
• Gene name: TNF alpha induced protein 8 like 2
• Alternate names: tumor necrosis factor alpha-induced protein 8-like protein 2, TNF alpha-induced protein 8-like protein 2, TNFAIP8-like protein 2, inflammation factor 20, inflammation factor protein 20, tumor necrosis factor, alpha induced protein 8 like 2, tumor necrosis facto,
• Gene location: 1q21.3 (151156648: 151159748)     Exons: 2     NC_000001.11
• OMIM: 608478

Protein Summary

• Protein general information: Q6P589  
  • Name: Tumor necrosis factor alpha induced protein 8 like protein 2 (TIPE2) (TNF alpha induced protein 8 like protein 2) (TNFAIP8 like protein 2) (Inflammation factor protein 20)
  • Length: 184  
  • Mass: 20556
• Sequence:

  MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHR
  NGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHF
  SDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL

• Structural information:
  • Interpro: IPR008477  IPR038355  
  • PDB: 3F4M
  • PDBsum: 3F4M
  • DIP: 60326
  • STRING: ENSP00000357906
• Other Databases: GeneCards:  TNFAIP8L2  Malacards:  TNFAIP8L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0050728	negative regulation of inflammatory response	IBA	biological process
GO:0050868	negative regulation of T cell activation	IBA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050868	negative regulation of T cell activation	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray