• Gene id: 79622

Gene Summary

• Gene Symbol: SNRNP25   Gene   UCSC   Ensembl
• Aliases: C16orf33
• Gene name: small nuclear ribonucleoprotein U11/U12 subunit 25
• Alternate names: U11/U12 small nuclear ribonucleoprotein 25 kDa protein, U11/U12 snRNP 25 kDa protein, U11/U12 snRNP 25K, minus-99 protein, small nuclear ribonucleoprotein 25kDa (U11/U12), small nuclear ribonucleoprotein, U11/U12 25kDa subunit,
• Gene location: 16p13.3 (58546725: 58480718)     Exons: 9     NC_000001.11
• Gene summary(Entrez): Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes a

Protein Summary

• Protein general information: Q9BV90  
  • Name: U11/U12 small nuclear ribonucleoprotein 25 kDa protein (U11/U12 snRNP 25 kDa protein) (U11/U12 25K) (Minus 99 protein)
  • Length: 132  
  • Mass: 15270
• Sequence:

  MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKAIQRYVQ
  LKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK

• Structural information:
  • Protein Domains: (41..13-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR039690  IPR040610  IPR000626  IPR029071  
  • Prosite: PS50053
  • STRING: ENSP00000372482
• Other Databases: GeneCards:  SNRNP25  Malacards:  SNRNP25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008380	RNA splicing	IC	biological process
GO:0005689	U12-type spliceosomal complex	IDA	cellular component
GO:0005689	U12-type spliceosomal complex	IBA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IEA	biological process
GO:0005689	U12-type spliceosomal complex	IEA	cellular component
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq