• Gene id: 79621

Gene Summary

• Gene Symbol: RNASEH2B   Gene   UCSC   Ensembl
• Aliases: AGS2, DLEU8
• Gene name: ribonuclease H2 subunit B
• Alternate names: ribonuclease H2 subunit B, Aicardi-Goutieres syndrome 2 protein, RNase H2 subunit B, deleted in lymphocytic leukemia 8, ribonuclease HI subunit B,
• Gene location: 13q14.3 (50909677: 50970461)     Exons: 17     NC_000013.11
• Gene summary(Entrez): RNase H2 is composed of a single catalytic subunit (A) and two non-catalytic subunits (B and C) and specifically degrades the RNA of RNA:DNA hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to play a r
• OMIM: 610326

Protein Summary

• Protein general information: Q5TBB1  
  • Name: Ribonuclease H2 subunit B (RNase H2 subunit B) (Aicardi Goutieres syndrome 2 protein) (AGS2) (Deleted in lymphocytic leukemia 8) (Ribonuclease HI subunit B)
  • Length: 312  
  • Mass: 35139
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MAAGVDCGDGVGARQHVFLVSEYLKDASKKMKNGLMFVKLVNPCSGEGAIYLFNMCLQQLFEVKVFKEKHHSWFI
  NQSVQSGGLLHFATPVDPLFLLLHYLIKADKEGKFQPLDQVVVDNVFPNCILLLKLPGLEKLLHHVTEEKGNPEI
  DNKKYYKYSKEKTLKWLEKKVNQTVAALKTNNVNVSSRVQSTAFFSGDQASTDKEEDYIRYAHGLISDYIPKELS
  DDLSKYLKLPEPSASLPNPPSKKIKLSDEPVEAKEDYTKFNTKDLKTEKKNSKMTAAQKALAKVDKSGMKSIDTF
  FGVKNKKKIGKV

• Structural information:
  • Interpro: IPR040456  IPR019024  IPR041195  
  • CDD: cd09270
  • PDB: 3P56 3P87 3PUF
  • PDBsum: 3P56 3P87 3PUF
  • STRING: ENSP00000337623
• Other Databases: GeneCards:  RNASEH2B  Malacards:  RNASEH2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004523	RNA-DNA hybrid ribonuclease activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0009259	ribonucleotide metabolic process	IBA	biological process
GO:0032299	ribonuclease H2 complex	IBA	cellular component
GO:0005654	nucleoplasm	IBA	cellular component
GO:0006401	RNA catabolic process	IBA	biological process
GO:0006401	RNA catabolic process	IDA	biological process
GO:0032299	ribonuclease H2 complex	IDA	cellular component
GO:0032299	ribonuclease H2 complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0010389	regulation of G2/M transition of mitotic cell cycle	IEA	biological process
GO:2000001	regulation of DNA damage checkpoint	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0032299	ribonuclease H2 complex	IEA	cellular component
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0009259	ribonucleotide metabolic process	IEA	biological process
GO:0004523	RNA-DNA hybrid ribonuclease activity	IEA	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03030	DNA replication

Diseases

Associated diseases	References
Aicardi-Goutieres syndrome	KEGG:H00290
Aicardi-Goutieres syndrome	KEGG:H00290
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881