• Gene id: 79605

Gene Summary

• Gene Symbol: PGBD5   Gene   UCSC   Ensembl
• Gene name: piggyBac transposable element derived 5
• Alternate names: piggyBac transposable element-derived protein 5, piggyBac domain related protein 5, piggyBac transposase 5,
• Gene location: 1q42.13 (230426331: 230314489)     Exons: 7     NC_000001.11
• Gene summary(Entrez): The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to
• OMIM: 614126

Protein Summary

• Protein general information: Q8N414  
  • Name: PiggyBac transposable element derived protein 5 (EC 3.1. . ) (PiggyBac domain related protein 5) (PiggyBac transposase 5)
  • Length: 524  
  • Mass: 58464
• Sequence:

  MAEGGGGARRRAPALLEAARARYESLHISDDVFGESGPDSGGNPFYSTSAASRSSSAASSDDEREPPGPPGAAPP
  PPRAPDAQEPEEDEAGAGWSAALRDRPPPRFEDTGGPTRKMPPSASAVDFFQLFVPDNVLKNMVVQTNMYAKKFQ
  ERFGSDGAWVEVTLTEMKAFLGYMISTSISHCESVLSIWSGGFYSNRSLALVMSQARFEKILKYFHVVAFRSSQT
  THGLYKVQPFLDSLQNSFDSAFRPSQTQVLHEPLIDEDPVFIATCTERELRKRKKRKFSLWVRQCSSTGFIIQIY
  VHLKEGGGPDGLDALKNKPQLHSMVARSLCRNAAGKNYIIFTGPSITSLTLFEEFEKQGIYCCGLLRARKSDCTG
  LPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAYSPVQQGVIIKRKSGEIPCPLAVEAFAAHLSY
  ICRYDDKYSKYFISHKPNKTWQQVFWFAISIAINNAYILYKMSDAYHVKRYSRAQFGERLVRELLGLEDASPTH

• Structural information:
  • Interpro: IPR029526  IPR042423  
  • STRING: ENSP00000431404
• Other Databases: GeneCards:  PGBD5  Malacards:  PGBD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004803	transposase activity	IBA	molecular function
GO:0098038	non-replicative transposition, DNA-mediated	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004803	transposase activity	IEA	molecular function
GO:0098038	non-replicative transposition, DNA-mediated	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0032196	transposition	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0004803	transposase activity	IDA	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0004803	transposase activity	IMP	molecular function
GO:0098038	non-replicative transposition, DNA-mediated	IMP	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray