Male Infertility Database

Search Result

Gene id

79603

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

CERS4 Gene UCSC Ensembl

Aliases

LASS4, Trh1

Gene name

ceramide synthase 4

Alternate names

ceramide synthase 4, LAG1 homolog, ceramide synthase 4, LAG1 longevity assurance homolog 4, sphingosine N-acyltransferase CERS4,

Gene location

19p13.2 (8209328: 8262432) Exons: 17 NC_000019.10

OMIM

602746

Protein Summary

Protein general information

Q9HA82

Name: Ceramide synthase 4 (CerS4) (EC 2.3.1. ) (LAG1 longevity assurance homolog 4) (Sphingosine N acyltransferase CERS4) (EC 2.3.1.24)

Length: 394 Mass: 46399

Sequence

MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGVRDQTR
RQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWRFLFYLSSFVGG
LSVLYHESWLWAPVMCWDRYPNQTLKPSLYWWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYS
ANLLRIGSLVLLLHDSSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRGPFF
GYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEAAAAQEPLQLKNGAAGGPRPAPT
DGPRSRVAGRLTNRHTTAT

Structural information

Protein Domains	(131..33-) (/note="TLC-) (/evidence="ECO:0000255\|PROSITE-ProRule:PRU00205"-)
Interpro:	IPR009057 IPR001356 IPR016439 IPR006634
Prosite:	PS50922
CDD:	cd00086
STRING:	ENSP00000251363

Other Databases

GeneCards: CERS4 Malacards: CERS4

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0016410	N-acyltransferase activit y	IBA	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0046513	ceramide biosynthetic pro cess	IBA	biological process
GO:0050291	sphingosine N-acyltransfe rase activity	IBA	molecular function
GO:0050291	sphingosine N-acyltransfe rase activity	IDA	molecular function
GO:0050291	sphingosine N-acyltransfe rase activity	IDA	molecular function
GO:0046513	ceramide biosynthetic pro cess	IDA	biological process
GO:0046513	ceramide biosynthetic pro cess	IDA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0050291	sphingosine N-acyltransfe rase activity	IEA	molecular function
GO:0030148	sphingolipid biosynthetic process	TAS	biological process
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050291	sphingosine N-acyltransfe rase activity	IEA	molecular function
GO:0046513	ceramide biosynthetic pro cess	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0030148	sphingolipid biosynthetic process	IEA	biological process
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular component
GO:0006665	sphingolipid metabolic pr ocess	IEA	biological process
GO:0016410	N-acyltransferase activit y	IBA	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0046513	ceramide biosynthetic pro cess	IBA	biological process
GO:0050291	sphingosine N-acyltransfe rase activity	IBA	molecular function
GO:0050291	sphingosine N-acyltransfe rase activity	IDA	molecular function
GO:0050291	sphingosine N-acyltransfe rase activity	IDA	molecular function
GO:0046513	ceramide biosynthetic pro cess	IDA	biological process
GO:0046513	ceramide biosynthetic pro cess	IDA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0050291	sphingosine N-acyltransfe rase activity	IEA	molecular function
GO:0030148	sphingolipid biosynthetic process	TAS	biological process
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050291	sphingosine N-acyltransfe rase activity	IEA	molecular function
GO:0046513	ceramide biosynthetic pro cess	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0030148	sphingolipid biosynthetic process	IEA	biological process
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular component
GO:0006665	sphingolipid metabolic pr ocess	IEA	biological process

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04071	Sphingolipid signaling pathway
hsa00600	Sphingolipid metabolism

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28606200	Cryptorchi dism			Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All