• Gene id: 796

Gene Summary

• Gene Symbol: CALCA   Gene   UCSC   Ensembl
• Aliases: CALC1, CGRP, CGRP-I, CGRP-alpha, CGRP1, CT, KC, PCT
• Gene name: calcitonin related polypeptide alpha
• Alternate names: calcitonin, calcitonin gene-related peptide 1, alpha-type CGRP, calcitonin 1, calcitonin gene-related peptide I, calcitonin/calcitonin-related polypeptide, alpha, katacalcin,
• Gene location: 11p15.2 (14972360: 14966667)     Exons: 6     NC_000011.10
• Gene summary(Entrez): This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation
• OMIM: 605831

Protein Summary

• Protein general information: P01258  
  • Name: Calcitonin [Cleaved into: Calcitonin; Katacalcin (Calcitonin carboxyl terminal peptide) (CCP) (PDN 21)]
  • Length: 141  
  • Mass: 15467
• Sequence:

  MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQEREGS
  SLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN

• Structural information:
  • Interpro: IPR021118  IPR021117  IPR021116  IPR018360  IPR001693  
  • Prosite: PS00258
  • PDB: 2JXZ
  • PDBsum: 2JXZ
  • STRING: ENSP00000331746
• Other Databases: GeneCards:  CALCA  Malacards:  CALCA
• Protein general information: P06881  
  
  Name: Calcitonin gene related peptide 1 (Alpha type CGRP) (Calcitonin gene related peptide I) (CGRP I)
  
  Length: 128  Mass: 13899
• Sequence: MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQMKASELEQEQEREGS
  RIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFGRRRRDLQA
• Structural information:

  Interpro:	IPR021117  IPR021116  IPR018360  IPR015476  IPR001693
  Prosite:	PS00258
  PDB:	1LS7 6E3Y
  PDBsum:	1LS7 6E3Y

• Other Databases: GeneCards:  CALCA  Malacards:  CALCA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051480	regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0031716	calcitonin receptor binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0007568	aging	IEA	biological process
GO:0008016	regulation of heart contraction	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0045986	negative regulation of smooth muscle contraction	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006874	cellular calcium ion homeostasis	IEA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0009408	response to heat	IEA	biological process
GO:0030279	negative regulation of ossification	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0043195	terminal bouton	IEA	cellular component
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0045986	negative regulation of smooth muscle contraction	IEA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0042311	vasodilation	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0001984	artery vasodilation involved in baroreceptor response to increased systemic arterial blood pressure	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0007190	activation of adenylate cyclase activity	IEA	biological process
GO:0007631	feeding behavior	IEA	biological process
GO:0031716	calcitonin receptor binding	IEA	molecular function
GO:0048265	response to pain	IEA	biological process
GO:0050965	detection of temperature stimulus involved in sensory perception of pain	IEA	biological process
GO:0002548	monocyte chemotaxis	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IDA	biological process
GO:0032147	activation of protein kinase activity	IDA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0007566	embryo implantation	IDA	biological process
GO:0045779	negative regulation of bone resorption	IDA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0031716	calcitonin receptor binding	IPI	molecular function
GO:0031716	calcitonin receptor binding	IPI	molecular function
GO:0031716	calcitonin receptor binding	IPI	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IGI	biological process
GO:0097647	amylin receptor signaling pathway	IGI	biological process
GO:0097647	amylin receptor signaling pathway	IGI	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0010523	negative regulation of calcium ion transport into cytosol	IDA	biological process
GO:0051480	regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0097755	positive regulation of blood vessel diameter	IDA	biological process
GO:0045671	negative regulation of osteoclast differentiation	IDA	biological process
GO:0045651	positive regulation of macrophage differentiation	IDA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IDA	biological process
GO:0032730	positive regulation of interleukin-1 alpha production	IDA	biological process
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005102	signaling receptor binding	IDA	molecular function
GO:0002031	G protein-coupled receptor internalization	IDA	biological process
GO:0001935	endothelial cell proliferation	IDA	biological process
GO:0043542	endothelial cell migration	IDA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0007159	leukocyte cell-cell adhesion	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0001944	vasculature development	IDA	biological process
GO:0045779	negative regulation of bone resorption	IDA	biological process
GO:0031623	receptor internalization	IDA	biological process
GO:1990408	calcitonin gene-related peptide receptor signaling pathway	IDA	biological process
GO:0007190	activation of adenylate cyclase activity	IDA	biological process
GO:0007190	activation of adenylate cyclase activity	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0008217	regulation of blood pressure	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04270	Vascular smooth muscle contraction
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Osteoporosis	PMID:2502220
Migraine	PMID:20959432
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq