• Gene id: 79590

Gene Summary

• Gene Symbol: MRPL24   Gene   UCSC   Ensembl
• Aliases: L24mt, MRP-L18, MRP-L24
• Gene name: mitochondrial ribosomal protein L24
• Alternate names: 39S ribosomal protein L24, mitochondrial, mitochondrial large ribosomal subunit protein uL24m,
• Gene location: 1q23.1 (156741266: 156737302)     Exons: 7     NC_000001.11
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 602358

Protein Summary

• Protein general information: Q96A35  
  • Name: 39S ribosomal protein L24, mitochondrial (L24mt) (MRP L24) (Mitochondrial large ribosomal subunit protein uL24m)
  • Length: 216  
  • Mass: 24915
• Sequence:

  MRLSALLALASKVTLPPHYRYGMSPPGSVADKRKNPPWIRRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGK
  VVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAGERVRVSTRS
  GRIIPKPEFPRADGIVPETWIDGPKDTSVEDALERTYVPCLKTLQEEVMEAMGIKETRKYKKVYWY

• Structural information:
  • Protein Domains: (56..8-)
    (/note="KOW"-)
  • Interpro: IPR005824  IPR041988  IPR014722  IPR003256  IPR005825   IPR008991  
  • Prosite: PS01108
  • CDD: cd06089
  • PDB: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000354525
• Other Databases: GeneCards:  MRPL24  Malacards:  MRPL24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0006412	translation	IBA	biological process
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881