• Gene id: 79589

Gene Summary

• Gene Symbol: RNF128   Gene   UCSC   Ensembl
• Aliases: GRAIL
• Gene name: ring finger protein 128
• Alternate names: E3 ubiquitin-protein ligase RNF128, RING-type E3 ubiquitin transferase RNF128, gene related to anergy in lymphocytes protein, ring finger protein 128, E3 ubiquitin protein ligase,
• Gene location: Xq22.3 (106693837: 106797015)     Exons: 8     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a type I transmembrane protein that localizes to the endocytic pathway. This protein contains a RING zinc-finger motif and has been shown to possess E3 ubiquitin ligase activity. Expression of this gene in retrovirally
• OMIM: 608162

Protein Summary

• Protein general information: Q8TEB7  
  • Name: E3 ubiquitin protein ligase RNF128 (EC 2.3.2.27) (Gene related to anergy in lymphocytes protein) (GRAIL) (RING finger protein 128) (RING type E3 ubiquitin transferase RNF128)
  • Length: 428  
  • Mass: 46521
• Sequence:

  MGPPPGAGVSCRGGCGFSRLLAWCFLLALSPQAPGSRGAEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDS
  PLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPG
  TRNEVIPMSHPGAVDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSFFIITAATVGY
  FIFYSARRLRNARAQSRKQRQLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCAVCIELYKPNDLVRILTCNHIFH
  KTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEP
  PLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETAVREIKS

• Structural information:
  • Protein Domains: (75..18-)
    (/note="PA"-)
  • Interpro: IPR003137  IPR001841  IPR013083  
  • Prosite: PS50089
  • PDB: 3ICU
  • PDBsum: 3ICU
  • STRING: ENSP00000255499
• Other Databases: GeneCards:  RNF128  Malacards:  RNF128

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005770	late endosome	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0042036	negative regulation of cytokine biosynthetic process	IEA	biological process
GO:0005770	late endosome	IEA	cellular component
GO:1904352	positive regulation of protein catabolic process in the vacuole	IC	biological process
GO:0061462	protein localization to lysosome	IC	biological process
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	NAS	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0012505	endomembrane system	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881