About Us

Search Result


Gene id 79581
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol SLC52A2   Gene   UCSC   Ensembl
Aliases BVVLS2, D15Ertd747e, GPCR41, GPR172A, PAR1, RFT3, RFVT2, hRFT3
Gene name solute carrier family 52 member 2
Alternate names solute carrier family 52, riboflavin transporter, member 2, G protein-coupled receptor 172A, PERV-A receptor 1, porcine endogenous retrovirus A receptor 1, putative G-protein coupled receptor GPCR41, riboflavin transporter 3, solute carrier family 52 (riboflavi,
Gene location 8q24.3 (144358546: 144361271)     Exons: 7     NC_000008.11
Gene summary(Entrez) This gene encodes a membrane protein which belongs to the riboflavin transporter family. In humans, riboflavin must be obtained by intestinal absorption because it cannot be synthesized by the body. The water-soluble vitamin riboflavin is processed to the
OMIM 610053

Protein Summary

Protein general information Q9HAB3  

Name: Solute carrier family 52, riboflavin transporter, member 2 (Porcine endogenous retrovirus A receptor 1) (PERV A receptor 1) (Protein GPR172A) (Riboflavin transporter 3) (hRFT3)

Length: 445  Mass: 45777

Tissue specificity: Highly expressed in brain, fetal brain and salivary gland. Weakly expressed in other tissues. {ECO

Sequence MAAPTPARPVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNLGLLVVTLWRRLAPGK
DEQVPIRVVQVLGMVGTALLASLWHHVAPVAGQLHSVAFLALAFVLALACCASNVTFLPFLSHLPPRFLRSFFLG
QGLSALLPCVLALVQGVGRLECPPAPINGTPGPPLDFLERFPASTFFWALTALLVASAAAFQGLLLLLPPPPSVP
TGELGSGLQVGAPGAEEEVEESSPLQEPPSQAAGTTPGPDPKAYQLLSARSACLLGLLAATNALTNGVLPAVQSF
SCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLGGLSLLGVFCGGYLMALAVLSPCPPLVGTSAGVVLV
VLSWVLCLGVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAVAMFPPTSIYHVFHSRKDCADPCDS
Structural information
Interpro:  IPR009357  
MINT:  
STRING:   ENSP00000436768
Other Databases GeneCards:  SLC52A2  Malacards:  SLC52A2

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0032218 riboflavin transport
IBA biological process
GO:0032217 riboflavin transmembrane
transporter activity
IBA molecular function
GO:0005887 integral component of pla
sma membrane
IBA cellular component
GO:0032218 riboflavin transport
IDA biological process
GO:0032218 riboflavin transport
IDA biological process
GO:0005886 plasma membrane
IDA cellular component
GO:0032217 riboflavin transmembrane
transporter activity
IDA molecular function
GO:0005887 integral component of pla
sma membrane
IDA cellular component
GO:0032218 riboflavin transport
IEA biological process
GO:0005887 integral component of pla
sma membrane
IEA cellular component
GO:0032217 riboflavin transmembrane
transporter activity
IEA molecular function
GO:0001618 virus receptor activity
IEA molecular function
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0006771 riboflavin metabolic proc
ess
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005886 plasma membrane
IEA cellular component
GO:0046718 viral entry into host cel
l
IEA biological process
GO:0062124 4-hydroxybutyrate recepto
r activity
IDA molecular function
GO:0005886 plasma membrane
IDA cellular component
Associated diseases References
Brown-Vialetto-Van Laere syndrome KEGG:H01903
Brown-Vialetto-Van Laere syndrome KEGG:H01903
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract