• Gene id: 79541

Gene Summary

• Gene Symbol: OR2A4   Gene   UCSC   Ensembl
• Aliases: OR2A10
• Gene name: olfactory receptor family 2 subfamily A member 4
• Alternate names: olfactory receptor 2A4, olfactory receptor 2A10, olfactory receptor OR6-37, olfactory receptor, family 2, subfamily A, member 10,
• Gene location: 6q23.2 (131701400: 131699643)     Exons: 1     NC_000006.12
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
• OMIM: 616594

Protein Summary

• Protein general information: O95047  
  • Name: Olfactory receptor 2A4 (Olfactory receptor 2A10) (Olfactory receptor OR6 37)
  • Length: 310  
  • Mass: 34802
• Sequence:

  MGDNITSIREFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYFFLSHLAVVDIAYACN
  TVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYDLYVAICHPLRYLAIMTWRVCITLAVTSWTT
  GVLLSLIHLVLLLPLPFCRPQKIYHFFCEILAVLKLACADTHINENMVLAGAISGLVGPLSTIVVSYMCILCAIL
  QIQSREVQRKAFRTCFSHLCVIGLVYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTL
  KRVLGVERAL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS50262
  • STRING: ENSP00000319546
• Other Databases: GeneCards:  OR2A4  Malacards:  OR2A4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0090543	Flemming body	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0032154	cleavage furrow	IDA	cellular component
GO:1990023	mitotic spindle midzone	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0032956	regulation of actin cytoskeleton organization	IMP	biological process
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0090543	Flemming body	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0032154	cleavage furrow	IDA	cellular component
GO:1990023	mitotic spindle midzone	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0032956	regulation of actin cytoskeleton organization	IMP	biological process
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0003674	molecular_function	ND	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq