• Gene id: 79444

Gene Summary

• Gene Symbol: BIRC7   Gene   UCSC   Ensembl
• Aliases: KIAP, LIVIN, ML-IAP, MLIAP, RNF50
• Gene name: baculoviral IAP repeat containing 7
• Alternate names: baculoviral IAP repeat-containing protein 7, RING finger protein 50, RING-type E3 ubiquitin transferase BIRC7, kidney inhibitor of apoptosis protein, livin inhibitor of apoptosis, melanoma inhibitor of apoptosis protein,
• Gene location: 20q13.33 (63235904: 63240494)     Exons: 7     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the inhibitor of apoptosis protein (IAP) family, and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with c
• OMIM: 605737

Protein Summary

• Protein general information: Q96CA5  
  • Name: Baculoviral IAP repeat containing protein 7 (EC 2.3.2.27) (Kidney inhibitor of apoptosis protein) (KIAP) (Livin) (Melanoma inhibitor of apoptosis protein) (ML IAP) (RING finger protein 50) (RING type E3 ubiquitin transferase BIRC7) [Cleaved into: Baculovi
  • Length: 298  
  • Mass: 32798
  • Tissue specificity: Isoform 1 and isoform 2 are expressed at very low levels or not detectable in most adult tissues. Detected in adult heart, placenta, lung, lymph node, spleen and ovary, and in several carcinoma cell lines. Isoform 2 is detected in feta
• Sequence:

  MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATL
  SRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPS
  CQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQ
  RAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS

• Structural information:
  • Interpro: IPR001370  IPR001841  IPR013083  IPR017907  
  • Prosite: PS01282 PS50143 PS00518 PS50089
  • CDD: cd00022
  • PDB: 1OXN 1OXQ 1OY7 1TW6 2I3H 2I3I 3F7G 3F7H 3F7I 3GT9 3GTA 3UW5 4AUQ
  • PDBsum: 1OXN 1OXQ 1OY7 1TW6 2I3H 2I3I 3F7G 3F7H 3F7I 3GT9 3GTA 3UW5 4AUQ
  • DIP: 33486
  • STRING: ENSP00000217169
• Other Databases: GeneCards:  BIRC7  Malacards:  BIRC7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0031398	positive regulation of protein ubiquitination	IBA	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IBA	molecular function
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:1990001	inhibition of cysteine-type endopeptidase activity involved in apoptotic process	IBA	biological process
GO:0042127	regulation of cell population proliferation	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0070247	regulation of natural killer cell apoptotic process	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	TAS	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0019899	enzyme binding	NAS	molecular function
GO:0043066	negative regulation of apoptotic process	NAS	biological process
GO:0007257	activation of JUN kinase activity	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04120	Ubiquitin mediated proteolysis
hsa05145	Toxoplasmosis
hsa05222	Small cell lung cancer
hsa04215	Apoptosis - multiple species

Diseases

Associated diseases	References
Colorectal adenoma	PMID:21122381
colorectal adenocarcinoma	PMID:21122381
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq