• Gene id: 79443

Gene Summary

• Gene Symbol: FYCO1   Gene   UCSC   Ensembl
• Aliases: CATC2, CTRCT18, RUFY3, ZFYVE7
• Gene name: FYVE and coiled-coil domain autophagy adaptor 1
• Alternate names: FYVE and coiled-coil domain-containing protein 1, FYVE and coiled-coil domain containing 1, RUN and FYVE domain containing 3, zinc finger FYVE domain-containing protein 7,
• Gene location: 3p21.31 (45995823: 45917902)     Exons: 21     NC_000003.12
• Gene summary(Entrez): This gene encodes a protein that contains a RUN domain, FYVE-type zinc finger domain and Golgi dynamics (GOLD) domain. The encoded protein plays a role in microtubule plus end-directed transport of autophagic vesicles through interactions with the small G
• OMIM: 609599

Protein Summary

• Protein general information: Q9BQS8  
  • Name: FYVE and coiled coil domain containing protein 1 (Zinc finger FYVE domain containing protein 7)
  • Length: 1478  
  • Mass: 166983
  • Tissue specificity: Expressed in heart and skeletal muscle. {ECO
• Sequence:

  MASTNAESQLQRIIRDLQDAVTELSKEFQEAGEPITDDSTSLHKFSYKLEYLLQFDQKEKATLLGNKKDYWDYFC
  ACLAKVKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQRLADTLQQCFMNTKVTSDWYYARSPFLQPKLSSDI
  VGQLYELTEVQFDLASRGFDLDAAWPTFARRTLTTGSSAYLWKPPSRSSSMSSLVSSYLQTQEMVSNFDLNSPLN
  NEALEGFDEMRLELDQLEVREKQLRERMQQLDRENQELRAAVSQQGEQLQTERERGRTAAEDNVRLTCLVAELQK
  QWEVTQATQNTVKELQTCLQGLELGAAEKEEDYHTALRRLESMLQPLAQELEATRDSLDKKNQHLASFPGWLAMA
  QQKADTASDTKGRQEPIPSDAAQEMQELGEKLQALERERTKVEEVNRQQSAQLEQLVKELQLKEDARASLERLVK
  EMAPLQEELSGKGQEADQLWRRLQELLAHTSSWEEELAELRREKKQQQEEKELLEQEVRSLTRQLQFLETQLAQV
  SQHVSDLEEQKKQLIQDKDHLSQQVGMLERLAGPPGPELPVAGEKNEALVPVNSSLQEAWGKPEEEQRGLQEAQL
  DDTKVQEGSQEEELRQANRELEKELQNVVGRNQLLEGKLQALQADYQALQQRESAIQGSLASLEAEQASIRHLGD
  QMEASLLAVRKAKEAMKAQMAEKEAILQSKEGECQQLREEVEQCQQLAEARHRELRALESQCQQQTQLIEVLTAE
  KGQQGVGPPTDNEARELAAQLALSQAQLEVHQGEVQRLQAQVVDLQAKMRAALDDQDKVQSQLSMAEAVLREHKT
  LVQQLKEQNEALNRAHVQELLQCSEREGALQEERADEAQQREEELRALQEELSQAKCSSEEAQLEHAELQEQLHR
  ANTDTAELGIQVCALTVEKERVEEALACAVQELQDAKEAASREREGLERQVAGLQQEKESLQEKLKAAKAAAGSL
  PGLQAQLAQAEQRAQSLQEAAHQELNTLKFQLSAEIMDYQSRLKNAGEECKSLRGQLEEQGRQLQAAEEAVEKLK
  ATQADMGEKLSCTSNHLAECQAAMLRKDKEGAALREDLERTQKELEKATTKIQEYYNKLCQEVTNRERNDQKMLA
  DLDDLNRTKKYLEERLIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFSWMVRRHHCRICGR
  IFCYYCCNNYVLSKHGGKKERCCRACFQKLSEGPGSPDSSGSGTSQGEPSPALSPASPGPQATGGQGANTDYRPP
  DDAVFDIITDEELCQIQESGSSLPETPTETDSLDPNAAEQDTTSTSLTPEDTEDMPVGQDSEICLLKSGELMIKV
  PLTVDEIASFGEGSRELFVRSSTYSLIPITVAEAGLTISWVFSSDPKSISFSVVFQEAEDTPLDQCKVLIPTTRC
  NSHKENIQGQLKVRTPGIYMLIFDNTFSRFVSKKVFYHLTVDRPVIYDGSDFL

• Structural information:
  • Protein Domains: (36..16-)
    (/note="RUN-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00178-)
    (1337..146-)
    (/note="GOLD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00096"-)
  • Interpro: IPR042654  IPR009038  IPR036598  IPR004012  IPR037213   IPR000306  IPR017455  IPR011011  IPR013083  
  • Prosite: PS50866 PS50826 PS50178
  • PDB: 5CX3 5D94
  • PDBsum: 5CX3 5D94
  • DIP: 60600
  • STRING: ENSP00000296137
• Other Databases: GeneCards:  FYCO1  Malacards:  FYCO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901098	positive regulation of autophagosome maturation	IMP	biological process
GO:0072383	plus-end-directed vesicle transport along microtubule	IBA	biological process
GO:0005764	lysosome	IBA	cellular component
GO:1901098	positive regulation of autophagosome maturation	IBA	biological process
GO:0005776	autophagosome	IBA	cellular component
GO:0005770	late endosome	IBA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0072383	plus-end-directed vesicle transport along microtubule	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0072383	plus-end-directed vesicle transport along microtubule	IEA	biological process
GO:1901098	positive regulation of autophagosome maturation	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005776	autophagosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Cataract	KEGG:H01202
Cataract	KEGG:H01202
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R