• Gene id: 79442

Gene Summary

• Gene Symbol: LRRC2   Gene   UCSC   Ensembl
• Gene name: leucine rich repeat containing 2
• Alternate names: leucine-rich repeat-containing protein 2,
• Gene location: 3p21.31 (46580098: 46515384)     Exons: 4     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the leucine-rich repeat-containing family of proteins, which function in diverse biological pathways. This family member may possibly be a nuclear protein. Similarity to the RAS suppressor protein, as well as expression down-
• OMIM: 607180

Protein Summary

• Protein general information: Q9BYS8  
  • Name: Leucine rich repeat containing protein 2
  • Length: 371  
  • Mass: 42943
• Sequence:

  MGHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFIDTSVRL
  LDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYIQLFQAMRILD
  LPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGNLELMELPFELSNLKQVTFVDISANK
  FSSVPICVLRMSNLQWLDISSNNLTDLPQDIDRLEELQSFLLYKNKLTYLPYSMLNLKKLTLLVVSGDHLVELPT
  ALCDSSTPLKFVSLMDNPIDNAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQL

• Structural information:
  • Interpro: IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • STRING: ENSP00000379241
• Other Databases: GeneCards:  LRRC2  Malacards:  LRRC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)