• Gene id: 79414

Gene Summary

• Gene Symbol: LRFN3   Gene   UCSC   Ensembl
• Aliases: FIGLER1, SALM4
• Gene name: leucine rich repeat and fibronectin type III domain containing 3
• Alternate names: leucine-rich repeat and fibronectin type-III domain-containing protein 3, fibronectin type III, immunoglobulin and leucine rich repeat domains 1, synaptic adhesion-like molecule 4,
• Gene location: 19q13.12 (35936373: 35946623)     Exons: 3     NC_000019.10

Protein Summary

• Protein general information: Q9BTN0  
  • Name: Leucine rich repeat and fibronectin type III domain containing protein 3 (Synaptic adhesion like molecule 4)
  • Length: 628  
  • Mass: 66260
• Sequence:

  MAILPLLLCLLPLAPASSPPQSATPSPCPRRCRCQTQSLPLSVLCPGAGLLFVPPSLDRRAAELRLADNFIASVR
  RRDLANMTGLLHLSLSRNTIRHVAAGAFADLRALRALHLDGNRLTSLGEGQLRGLVNLRHLILSNNQLAALAAGA
  LDDCAETLEDLDLSYNNLEQLPWEALGRLGNVNTLGLDHNLLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPLF
  SRLPLLARPRGSPASALVLAFGGNPLHCNCELVWLRRLAREDDLEACASPPALGGRYFWAVGEEEFVCEPPVVTH
  RSPPLAVPAGRPAALRCRAVGDPEPRVRWVSPQGRLLGNSSRARAFPNGTLELLVTEPGDGGIFTCIAANAAGEA
  TAAVELTVGPPPPPQLANSTSCDPPRDGDPDALTPPSAASASAKVADTGPPTDRGVQVTEHGATAALVQWPDQRP
  IPGIRMYQIQYNSSADDILVYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFSTEPALR
  PCGAPHAPFLGGTMIIALGGVIVASVLVFIFVLLMRYKVHGGQPPGKAKIPAPVSSVCSQTNGALGPTPTPAPPA
  PEPAALRAHTVVQLDCEPWGPGHEPVGP

• Structural information:
  • Protein Domains: (19..5-)
    (/note="LRRNT-)
    (249..29-)
    (/note="LRRCT-)
    (295..38-)
    (/note="Ig-like-)
    (425..52-)
    (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR000483  IPR003961  IPR036116  IPR007110  IPR036179   IPR013783  IPR013098  IPR003599  IPR003598  IPR001611  IPR003591  IPR032675  
  • Prosite: PS50853 PS50835
  • CDD: cd00063
  • STRING: ENSP00000466989
• Other Databases: GeneCards:  LRFN3  Malacards:  LRFN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1905606	regulation of presynapse assembly	IBA	biological process
GO:0098978	glutamatergic synapse	IBA	cellular component
GO:0099560	synaptic membrane adhesion	IBA	biological process
GO:0099179	regulation of synaptic membrane adhesion	IBA	biological process
GO:0099061	integral component of postsynaptic density membrane	IBA	cellular component
GO:0099059	integral component of presynaptic active zone membrane	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0099560	synaptic membrane adhesion	IEA	biological process
GO:0099179	regulation of synaptic membrane adhesion	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0099060	integral component of postsynaptic specialization membrane	IEA	cellular component
GO:0099059	integral component of presynaptic active zone membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq