• Gene id: 79413

Gene Summary

• Gene Symbol: ZBED2   Gene   UCSC   Ensembl
• Gene name: zinc finger BED-type containing 2
• Alternate names: zinc finger BED domain-containing protein 2, zinc finger, BED domain containing 2,
• Gene location: 3q13.13 (111595345: 111592899)     Exons: 2     NC_000003.12
• OMIM: 124040

Protein Summary

• Protein general information: Q9BTP6  
  • Name: Zinc finger BED domain containing protein 2
  • Length: 218  
  • Mass: 25122
• Sequence:

  MMRREDEEEEGTMMKAKGDLEMKEEEEISETGELVGPFVSAMPTPMPHNKGTRFSEAWEYFHLAPARAGHHPNQY
  ATCRLCGRQVSRGPGVNVGTTALWKHLKSMHREELEKSGHGQAGQRQDPRPHGPQLPTGIEGNWGRLLEQVGTMA
  LWASQREKEVLRRERAVEWRERAVEKRERALEEVERAILEMKWKVRAEKEACQREKELPAAVHPFHFV

• Structural information:
  • Interpro: IPR003656  IPR036236  
  • Prosite: PS50808
  • PDB: 2DJR
  • PDBsum: 2DJR
  • STRING: ENSP00000321370
• Other Databases: GeneCards:  ZBED2  Malacards:  ZBED2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881