• Gene id: 7941

Gene Summary

• Gene Symbol: PLA2G7   Gene   UCSC   Ensembl
• Aliases: LDL-PLA2, LP-PLA2, PAFAD, PAFAH
• Gene name: phospholipase A2 group VII
• Alternate names: platelet-activating factor acetylhydrolase, 1-alkyl-2-acetylglycerophosphocholine esterase, 2-acetyl-1-alkylglycerophosphocholine esterase, LDL-PLA(2), LDL-associated phospholipase A2, PAF 2-acylhydrolase, PAF acetylhydrolase, gVIIA-PLA2, group-VIIA phospholipase,
• Gene location: 6p12.3 (46735835: 46700557)     Exons: 13     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript
• OMIM: 601690

Protein Summary

• Protein general information: Q13093  
  • Name: Platelet activating factor acetylhydrolase (PAF acetylhydrolase) (EC 3.1.1.47) (1 alkyl 2 acetylglycerophosphocholine esterase) (2 acetyl 1 alkylglycerophosphocholine esterase) (Group VIIA phospholipase A2) (gVIIA PLA2) (LDL associated phospholipase A2) (
  • Length: 441  
  • Mass: 50077
  • Tissue specificity: Plasma.
• Sequence:

  MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHT
  NKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFS
  HGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQR
  AKECSQALSLILDIDHGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMF
  PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKGDI
  DSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYN

• Structural information:
  • Interpro: IPR029058  IPR005065  IPR016715  
  • Prosite: PS00120
  • PDB: 3D59 3D5E 3F96 3F97 3F98 3F9C 5I8P 5I9I 5JAD 5JAH 5JAL 5JAN 5JAO 5JAP 5JAR 5JAS 5JAT 5JAU 5LP1 5LYY 5LZ2 5LZ4 5LZ5 5LZ7 5LZ8 5LZ9 5YE7 5YE8 5YE9 5YEA
  • PDBsum: 3D59 3D5E 3F96 3F97 3F98 3F9C 5I8P 5I9I 5JAD 5JAH 5JAL 5JAN 5JAO 5JAP 5JAR 5JAS 5JAT 5JAU 5LP1 5LYY 5LZ2 5LZ4 5LZ5 5LZ7 5LZ8 5LZ9 5YE7 5YE8 5YE9 5YEA
  • STRING: ENSP00000274793
• Other Databases: GeneCards:  PLA2G7  Malacards:  PLA2G7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity	IBA	molecular function
GO:0062234	platelet activating factor catabolic process	IDA	biological process
GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity	IDA	molecular function
GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity	IDA	molecular function
GO:0034362	low-density lipoprotein particle	IDA	cellular component
GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity	IDA	molecular function
GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity	IDA	molecular function
GO:0034362	low-density lipoprotein particle	IDA	cellular component
GO:0046469	platelet activating factor metabolic process	IDA	biological process
GO:0046469	platelet activating factor metabolic process	IDA	biological process
GO:0034364	high-density lipoprotein particle	IDA	cellular component
GO:0046469	platelet activating factor metabolic process	IDA	biological process
GO:0034638	phosphatidylcholine catabolic process	IDA	biological process
GO:0047499	calcium-independent phospholipase A2 activity	IDA	molecular function
GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0034362	low-density lipoprotein particle	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0009395	phospholipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0034364	high-density lipoprotein particle	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0016788	hydrolase activity, acting on ester bonds	TAS	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005543	phospholipid binding	IDA	molecular function
GO:0047499	calcium-independent phospholipase A2 activity	IDA	molecular function
GO:0034362	low-density lipoprotein particle	IDA	cellular component
GO:0050729	positive regulation of inflammatory response	TAS	biological process
GO:0034374	low-density lipoprotein particle remodeling	IDA	biological process
GO:0034440	lipid oxidation	IDA	biological process
GO:0034441	plasma lipoprotein particle oxidation	IDA	biological process
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:0003847	1-alkyl-2-acetylglycerophosphocholine esterase activity	IDA	molecular function
GO:0046469	platelet activating factor metabolic process	IDA	biological process
GO:0005615	extracellular space	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00565	Ether lipid metabolism

Diseases

Associated diseases	References
Sleep apnea	PMID:21698055
Glomerulosclerosis	PMID:16213192
Non-alcoholic fatty liver disease	PMID:22112193
Nephrotic syndrome type 2	PMID:9853251
Nephrotic syndrome	PMID:15292677
Hemolytic-uremic syndrome	PMID:10873870
Carotid stenosis	PMID:22075154
Dementia	PMID:16278861
Atherosclerosis	PMID:12590019
Multiple sclerosis	PMID:22246459
Asthma	PMID:10733466
Coronary artery disease	PMID:17070179
Coronary artery disease	PMID:15115767
Carotid artery disease	PMID:22499993
Cerebral infarction	PMID:18201705
Proteinuria	PMID:10430976
Myocardial infarction	PMID:19644070
congestive heart failure	PMID:16952920
Rheumatoid arthritis	PMID:17326817
Abdominal aortic aneurysm	PMID:11807372
type 2 diabetes mellitus	PMID:22399516
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R