• Gene id: 79400

Gene Summary

• Gene Symbol: NOX5   Gene   UCSC   Ensembl
• Gene name: NADPH oxidase 5
• Alternate names: NADPH oxidase 5, NADPH oxidase, EF-hand calcium binding domain 5,
• Gene location: 15q23 (68930499: 69057160)     Exons: 18     NC_000015.10
• Gene summary(Entrez): This gene is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes. It encodes a calcium-dependen NADPH oxidase that generates superoxide, and functions as a calcium-dependent proton channel that may regulate redox-depe
• OMIM: 606572

Protein Summary

• Protein general information: Q96PH1  
  • Name: NADPH oxidase 5 (EC 1.6.3. )
  • Length: 765  
  • Mass: 86,439
• Sequence:

  MNTSGDPAQTGPEGCRGTMSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESFFAERFFALFDSDRSG
  TITLQELQEALTLLIHGSPMDKLKFLFQVYDIDVCARQGASAGTEWGAGAGPHWASSPLGTGSGSIDPDELRTVL
  QSCLRESAISLPDEKLDQLTLALFESADADGNGAITFEELRDELQRFPGVMENLTISAAHWLTAPAPRPRPRRPR
  QLTRAYWHNHRSQLFCLATYAGLHVLLFGLAASAHRDLGASVMVAKGCGQCLNFDCSFIAVLMLRRCLTWLRATW
  LAQVLPLDQNIQFHQLMGYVVVGLSLVHTVAHTVNFVLQAQAEASPFQFWELLLTTRPGIGWVHGSASPTGVALL
  LLLLLMFICSSSCIRRSGHFEVFYWTHLSYLLVWLLLIFHGPNFWKWLLVPGILFFLEKAIGLAVSRMAAVCIME
  VNLLPSKVTHLLIKRPPFFHYRPGDYLYLNIPTIARYEWHPFTISSAPEQKDTIWLHIRSQGQWTNRLYESFKAS
  DPLGRGSKRLSRSVTMRKSQRSSKGSEILLEKHKFCNIKCYIDGPYGTPTRRIFASEHAVLIGAGIGITPFASIL
  QSIMYRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSFEWFVSLLTKLEMDQAEEAQYGRFLELHMY
  MTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDWSKVFQKVAAEKKGKVQVFFCGSPALAKVLK
  GHCEKFGFRFFQENF

• Structural information:
  • Protein Domains: EF-hand (26-56)
    EF-hand (57-92)
    EF-hand (93-156)
    (-)
    of (an-insert)
    (165-200)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR013112  IPR017927   IPR013130  IPR013121  IPR029648  IPR017938  
  • Prosite: PS00018 PS50222 PS51384
  • CDD: cd00051
  • STRING: ENSP00000373518
• Other Databases: GeneCards:  NOX5  Malacards:  NOX5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0000910	cytokinesis	NAS	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0001935	endothelial cell proliferation	IDA	biological process
GO:0001935	endothelial cell proliferation	IDA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006915	apoptotic process	NAS	biological process
GO:0008283	cell proliferation	NAS	biological process
GO:0010155	regulation of proton transport	NAS	biological process
GO:0015252	hydrogen ion channel activity	IDA	molecular function
GO:0015992	proton transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016175	superoxide-generating NADPH oxidase activity	IDA	molecular function
GO:0016175	superoxide-generating NADPH oxidase activity	TAS	molecular function
GO:0020037	heme binding	NAS	molecular function
GO:0042554	superoxide anion generation	IDA	biological process
GO:0043012	regulation of fusion of sperm to egg plasma membrane	NAS	biological process
GO:0050660	flavin adenine dinucleotide binding	NAS	molecular function
GO:0050661	NADP binding	NAS	molecular function
GO:0050663	cytokine secretion	NAS	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IDA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IDA	biological process
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0000910	cytokinesis	NAS	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0001935	endothelial cell proliferation	IDA	biological process
GO:0001935	endothelial cell proliferation	IDA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0006915	apoptotic process	NAS	biological process
GO:0008283	cell proliferation	NAS	biological process
GO:0010155	regulation of proton transport	NAS	biological process
GO:0015252	hydrogen ion channel activity	IDA	molecular function
GO:0015992	proton transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016175	superoxide-generating NADPH oxidase activity	IEA	molecular function
GO:0016175	superoxide-generating NADPH oxidase activity	IDA	molecular function
GO:0016175	superoxide-generating NADPH oxidase activity	TAS	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0020037	heme binding	NAS	molecular function
GO:0042554	superoxide anion generation	IEA	biological process
GO:0042554	superoxide anion generation	IDA	biological process
GO:0043012	regulation of fusion of sperm to egg plasma membrane	NAS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0050660	flavin adenine dinucleotide binding	NAS	molecular function
GO:0050661	NADP binding	NAS	molecular function
GO:0050663	cytokine secretion	NAS	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IDA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IDA	biological process
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0000910	cytokinesis	NAS	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0001935	endothelial cell proliferation	IDA	biological process
GO:0001935	endothelial cell proliferation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006915	apoptotic process	NAS	biological process
GO:0008283	cell proliferation	NAS	biological process
GO:0010155	regulation of proton transport	NAS	biological process
GO:0015252	hydrogen ion channel activity	IDA	molecular function
GO:0016175	superoxide-generating NADPH oxidase activity	IDA	molecular function
GO:0016175	superoxide-generating NADPH oxidase activity	TAS	molecular function
GO:0020037	heme binding	NAS	molecular function
GO:0042554	superoxide anion generation	IDA	biological process
GO:0043012	regulation of fusion of sperm to egg plasma membrane	NAS	biological process
GO:0050660	flavin adenine dinucleotide binding	NAS	molecular function
GO:0050661	NADP binding	NAS	molecular function
GO:0050663	cytokine secretion	NAS	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IDA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IDA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 23030296
Teratozoospermia	MIK: 23030296

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23030296	Teratozoospermia			25 (12 normozoospermic, 13 tetrazoospermic)	Male infertility