• Gene id: 7940

Gene Summary

• Gene Symbol: LST1   Gene   UCSC   Ensembl
• Aliases: B144, D6S49E, LST-1
• Gene name: leukocyte specific transcript 1
• Alternate names: leukocyte-specific transcript 1 protein, lymphocyte antigen 117,
• Gene location: 6p21.33 (31586184: 31588908)     Exons: 6     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a membrane protein that can inhibit the proliferation of lymphocytes. Expression of this gene is enhanced by lipopolysaccharide, interferon-gamma, and bacteria. Several transcript variants encoding different isoforms ha
• OMIM: 600386

Protein Summary

• Protein general information: O00453  
  • Name: Leukocyte specific transcript 1 protein (Protein B144)
  • Length: 97  
  • Mass: 10792
  • Tissue specificity: Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain. {ECO
• Sequence:

  MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGR
  DKRGTKEDPRADYACIAENKPT

• Structural information:
  • Interpro: IPR007775  
  • STRING: ENSP00000365261
• Other Databases: GeneCards:  LST1  Malacards:  LST1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016358	dendrite development	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0000902	cell morphogenesis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0050672	negative regulation of lymphocyte proliferation	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016358	dendrite development	IDA	biological process
GO:0006955	immune response	NAS	biological process
GO:0006955	immune response	NAS	biological process
GO:0009653	anatomical structure morphogenesis	NAS	biological process
GO:0005794	Golgi apparatus	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R