• Gene id: 79370

Gene Summary

• Gene Symbol: BCL2L14   Gene   UCSC   Ensembl
• Aliases: BCLG
• Gene name: BCL2 like 14
• Alternate names: apoptosis facilitator Bcl-2-like protein 14, BCL2-like 14 (apoptosis facilitator), apoptosis regulator BCL-G, bcl2-L-14, testicular tissue protein Li 26,
• Gene location: 12p13.2 (12049848: 12099694)     Exons: 12     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. Overexpression of this gene has be
• OMIM: 606126

Protein Summary

• Protein general information: Q9BZR8  
  • Name: Apoptosis facilitator Bcl 2 like protein 14 (Bcl2 L 14) (Apoptosis regulator Bcl G)
  • Length: 327  
  • Mass: 36598
  • Tissue specificity: Isoform 1 is widely expressed. Isoform 2 is testis-specific. {ECO
• Sequence:

  MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCR
  NSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKV
  ISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLER
  KLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKY
  LKENFSPWIQQHGGWEKILGISHEEVD

• Structural information:
  • Interpro: IPR002475  IPR033229  IPR036834  
  • Prosite: PS50062
  • STRING: ENSP00000309132
• Other Databases: GeneCards:  BCL2L14  Malacards:  BCL2L14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001236	regulation of extrinsic apoptotic signaling pathway	IBA	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0012505	endomembrane system	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043229	intracellular organelle	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Prostate cancer	PMID:14999772
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R