• Gene id: 79368

Gene Summary

• Gene Symbol: FCRL2   Gene   UCSC   Ensembl
• Aliases: CD307b, FCRH2, IFGP4, IRTA4, SPAP1, SPAP1A, SPAP1B, SPAP1C
• Gene name: Fc receptor like 2
• Alternate names: Fc receptor-like protein 2, IFGP family protein 4, SH2 domain containing phosphatase anchor protein 1, fc receptor homolog 2, immune receptor translocation-associated protein 4, immunoglobulin receptor translocation-associated protein 4, immunoglobulin superfam,
• Gene location: 1q23.1 (157777471: 157745732)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembran
• OMIM: 606509

Protein Summary

• Protein general information: Q96LA5  
  • Name: Fc receptor like protein 2 (FcR like protein 2) (FcRL2) (Fc receptor homolog 2) (FcRH2) (IFGP family protein 4) (Immunoglobulin receptor translocation associated protein 4) (SH2 domain containing phosphatase anchor protein 1) (CD antigen CD307b)
  • Length: 508  
  • Mass: 55542
  • Tissue specificity: Expressed in the secondary lymphoid organs, spleen and lymph node. Expression is limited to the mature B-cell lines. Highly expressed in CD19 and within the mantle zones of the tonsil tissue. Isoform 2 is expressed in the spleen, perip
• Sequence:

  MLLWSLLVIFDAVTEQADSLTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLS
  DSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQ
  VLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILL
  CSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRP
  VLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCEANNGLG
  AQCSEAVPVSISGPDGYRRDLMTAGVLWGLFGVLGFTGVALLLYALFHKISGESSATNEPRGASRPNPQEFTYSS
  PTPDMEELQPVYVNVGSVDVDVVYSQVWSMQQPESSANIRTLLENKDSQVIYSSVKKS

• Structural information:
  • Protein Domains: (20..9-)
    1 (/note="Ig-like-C2-type)
    (109..18-)
    2 (/note="Ig-like-C2-type)
    (201..29-)
    3 (/note="Ig-like-C2-type)
    (300..38-)
    4" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598  
  • Prosite: PS50835
  • STRING: ENSP00000355157
• Other Databases: GeneCards:  FCRL2  Malacards:  FCRL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0035591	signaling adaptor activity	IDA	molecular function
GO:0016021	integral component of membrane	NAS	cellular component
GO:0007267	cell-cell signaling	NAS	biological process
GO:0019903	protein phosphatase binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R