• Gene id: 79366

Gene Summary

• Gene Symbol: HMGN5   Gene   UCSC   Ensembl
• Aliases: NBP-45, NSBP1
• Gene name: high mobility group nucleosome binding domain 5
• Alternate names: high mobility group nucleosome-binding domain-containing protein 5, nucleosomal binding protein 1, nucleosome-binding protein 1,
• Gene location: Xq21.1 (81201912: 81113698)     Exons: 7     NC_000023.11
• Gene summary(Entrez): This gene encodes a nuclear protein with similarities to the high mobility group proteins, HMG14 and HMG17, which suggests that this protein may function as a nucleosomal binding and transcriptional activating protein. [provided by RefSeq, Sep 2009]
• OMIM: 300385

Protein Summary

• Protein general information: P82970  
  • Name: High mobility group nucleosome binding domain containing protein 5 (Nucleosome binding protein 1)
  • Length: 282  
  • Mass: 31525
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MPKRKAAGQGDMRQEPKRRSARLSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVVEED
  YNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAEVKNEEEDQKEDEEDQNEEKGEAGKEDKD
  EKGEEDGKEDKNGNEKGEDAKEKEDGKKGEDGKGNGEDGKEKGEDEKEEEDRKETGDGKENEDGKEKGDKKEGKD
  VKVKEDEKEREDGKEDEGGNEEEAGKEKEDLKEEEEGKEEDEIKEDDGKKEEPQSIV

• Structural information:
  • Interpro: IPR040164  IPR000079  
  • Prosite: PS00355
  • STRING: ENSP00000350848
• Other Databases: GeneCards:  HMGN5  Malacards:  HMGN5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0071157	negative regulation of cell cycle arrest	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0031492	nucleosomal DNA binding	IEA	molecular function
GO:0000785	chromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006325	chromatin organization	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0003682	chromatin binding	NAS	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0005634	nucleus	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R