• Gene id: 79228

Gene Summary

• Gene Symbol: THOC6   Gene   UCSC   Ensembl
• Aliases: WDR58, fSAP35
• Gene name: THO complex 6
• Alternate names: THO complex subunit 6 homolog, WD repeat domain 58, WD repeat-containing protein 58, functional spliceosome-associated protein 35,
• Gene location: 16p13.3 (3024034: 3027749)     Exons: 13     NC_000016.10
• Gene summary(Entrez): This gene encodes a subunit of the multi-protein THO complex, which is involved in coordination between transcription and mRNA processing. The THO complex is a component of the TREX (transcription/export) complex, which is involved in transcription and ex

Protein Summary

• Protein general information: Q86W42  
  • Name: THO complex subunit 6 homolog (Functional spliceosome associated protein 35) (fSAP35) (WD repeat containing protein 58)
  • Length: 341  
  • Mass: 37535
• Sequence:

  MERAVPLAVPLGQTEVFQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSSALSSEAKEESKKPVVTFQAH
  DGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPEINALLLVPKENSLILAGGDCQL
  HTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYKHEECSRPHNGRWIGC
  LATDSDWMVCGGGPALTLWHLRSSTPTTIFPIRAPQKHVTFYQDLILSAGQGRCVNQWQLSGELKAQVPGSSPGL
  LSLSLNQQPAAPECKVLTAAGNSCRVDVFTNLGYRAFSLSF

• Structural information:
  • Interpro: IPR042626  IPR015943  IPR001680  IPR019775  IPR017986   IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000326531
• Other Databases: GeneCards:  THOC6  Malacards:  THOC6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046784	viral mRNA export from host cell nucleus	IDA	biological process
GO:0000445	THO complex part of transcription export complex	IDA	cellular component
GO:0000347	THO complex	IDA	cellular component
GO:0006406	mRNA export from nucleus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0000346	transcription export complex	IDA	cellular component
GO:0000346	transcription export complex	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0007417	central nervous system development	IMP	biological process
GO:0051028	mRNA transport	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006405	RNA export from nucleus	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0000784	nuclear chromosome, telomeric region	IDA	colocalizes with
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Beaulieu-Boycott-Innes syndrome	KEGG:H02253
Beaulieu-Boycott-Innes syndrome	KEGG:H02253
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq