• Gene id: 7922

Gene Summary

• Gene Symbol: SLC39A7   Gene   UCSC   Ensembl
• Aliases: D6S115E, D6S2244E, H2-KE4, HKE4, KE4, RING5, ZIP7
• Gene name: solute carrier family 39 member 7
• Alternate names: zinc transporter SLC39A7, HLA class II region expressed gene KE4, Ke4 gene, mouse, human homolog of, histidine-rich membrane protein Ke4, really interesting new gene 5 protein, solute carrier family 39 (zinc transporter), member 7, zrt-, Irt-like protein 7,
• Gene location: 6p21.32 (33200866: 33204436)     Exons: 8     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene transports zinc from the Golgi and endoplasmic reticulum to the cytoplasm. This transport may be important for activation of tyrosine kinases, some of which could be involved in cancer progression. Therefore, modulation of

Protein Summary

• Protein general information: Q92504  
  • Name: Zinc transporter SLC39A7 (Histidine rich membrane protein Ke4) (Really interesting new gene 5 protein) (Solute carrier family 39 member 7) (Zrt , Irt like protein 7) (ZIP7)
  • Length: 469  
  • Mass: 50118
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSHAHGHGHTHESIWHGH
  THDHDHGHSHEDLHHGHSHGYSHESLYHRGHGHDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPF
  FVLFLIPVESNSPRHRSLLQILLSFASGGLLGDAFLHLIPHALEPHSHHTLEQPGHGHSHSGQGPILSVGLWVLS
  GIVAFLVVEKFVRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGP
  VRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGC
  SKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVLPFTAGGFIYVATVSVLPELLREASPLQSLL
  EVLGLLGGVIMMVLIAHLE

• Structural information:
  • Interpro: IPR003689  
  • STRING: ENSP00000363809
• Other Databases: GeneCards:  SLC39A7  Malacards:  SLC39A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071577	zinc ion transmembrane transport	IBA	biological process
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0030001	metal ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046873	metal ion transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005385	zinc ion transmembrane transporter activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray