• Gene id: 7920

Gene Summary

• Gene Symbol: ABHD16A   Gene   UCSC   Ensembl
• Aliases: BAT5, D6S82E, NG26, PP199, hBAT5
• Gene name: abhydrolase domain containing 16A, phospholipase
• Alternate names: phosphatidylserine lipase ABHD16A, HLA-B associated transcript 5, abhydrolase domain containing 16A, abhydrolase domain-containing protein 16A, alpha/beta hydrolase domain-containing protein 16A, monoacylglycerol lipase ABHD16A, protein ABHD16A, protein G5,
• Gene location: 6p21.33 (31703323: 31686954)     Exons: 21     NC_000006.12
• Gene summary(Entrez): A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for tumor necrosis factor alpha and tumor necrosis factor beta. These genes are all within the human major histocompatibility complex class III region. The protein encoded by t
• OMIM: 142620

Protein Summary

• Protein general information: O95870  
  • Name: Phosphatidylserine lipase ABHD16A (EC 3.1. . ) (Alpha/beta hydrolase domain containing protein 16A) (Abhydrolase domain containing protein 16A) (HLA B associated transcript 5) (hBAT5) (Monoacylglycerol lipase ABHD16A) (EC 3.1.1.23) (Protein G5)
  • Length: 558  
  • Mass: 63243
• Sequence:

  MAKLLSCVLGPRLYKIYRERDSERAPASVPETPTAVTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSS
  PFAFFYLYRKGYLSLSKVVPFSHYAGTLLLLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSSENKRQLANYN
  FDFRSWPVDFHWEEPSSRKESRGGPSRRGVALLRPEPLHRGTADTLLNRVKKLPCQITSYLVAHTLGRRMLYPGS
  VYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTP
  LEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFTATWAAMSYPDVSAMI
  LDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIMSNRGNDLL
  LKLLQHRYPRVMAEEGLRVVRQWLEASSQLEEASIYSRWEVEEDWCLSVLRSYQAEHGPDFPWSVGEDMSADGRR
  QLALFLARKHLHNFEATHCTPLPAQNFQMPWHL

• Structural information:
  • Protein Domains: (281..40-)
    (/note="AB-hydrolase-1)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR029058  IPR000073  IPR026604  
  • STRING: ENSP00000379282
• Other Databases: GeneCards:  ABHD16A  Malacards:  ABHD16A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006660	phosphatidylserine catabolic process	IBA	biological process
GO:0047372	acylglycerol lipase activity	IBA	molecular function
GO:0004620	phospholipase activity	IBA	molecular function
GO:0052651	monoacylglycerol catabolic process	IBA	biological process
GO:0052651	monoacylglycerol catabolic process	IDA	biological process
GO:0047372	acylglycerol lipase activity	IDA	molecular function
GO:0004620	phospholipase activity	ISS	molecular function
GO:0006660	phosphatidylserine catabolic process	ISS	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0047372	acylglycerol lipase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0047372	acylglycerol lipase activity	IEA	molecular function
GO:0006660	phosphatidylserine catabolic process	IEA	biological process
GO:1905344	prostaglandin catabolic process	IEA	biological process
GO:0052651	monoacylglycerol catabolic process	IEA	biological process
GO:0004620	phospholipase activity	IEA	molecular function
GO:0004622	lysophospholipase activity	IDA	NOT|molecular function
GO:0047372	acylglycerol lipase activity	IDA	molecular function
GO:0052651	monoacylglycerol catabolic process	IDA	biological process
GO:1905344	prostaglandin catabolic process	IDA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray