• Gene id: 7917

Gene Summary

• Gene Symbol: BAG6   Gene   UCSC   Ensembl
• Aliases: BAG-6, BAT3, D6S52E, G3
• Gene name: BCL2 associated athanogene 6
• Alternate names: large proline-rich protein BAG6, BAG family molecular chaperone regulator 6, HLA-B-associated transcript 3, large proline-rich protein BAT3, protein G3, protein Scythe, scythe,
• Gene location: 6p21.33 (12791354: 12824226)     Exons: 7     NC_000023.11
• Gene summary(Entrez): This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In
• OMIM: 142590

Protein Summary

• Protein general information: P46379  
  • Name: Large proline rich protein BAG6 (BAG family molecular chaperone regulator 6) (BCL2 associated athanogene 6) (BAG 6) (HLA B associated transcript 3) (Protein G3) (Protein Scythe)
  • Length: 1132  
  • Mass: 119,409
• Sequence:

  MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEY
  NVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVH
  INMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMETLPYLQCRGGPQPQHSQPPPQPPAVTPEPVALSSQTSEPVE
  SEAPPREPMEAEEVEERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRLESRLQPFLQRYYEV
  LGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLHVVRPMSHYTTPMVLQQAAI
  PIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNVESSAEGAPPPGPAPPPATSHPRVIRISHQS
  VEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHGQTLGQQVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGT
  LQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTPQP
  SMADLQFSQLLGNLLGPAGPGAGGSGVASPTITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTM
  PPPGSPSGGAGSPGGLGLESLSPEFFTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGF
  FGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSL
  VQVQPGVDIIRTNLEFLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIR
  RMSRGVNPSLVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPA
  PGTTAEEAMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKR
  RKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQ
  RAFADDP

• Structural information:
  • Protein Domains: Ubiquitin-like. (17-92)
  • Interpro: IPR021925  IPR029071  IPR019954  IPR000626  
  • Prosite: PS00299 PS50053
  • PDB: 1WX9 2N9P 4DWF 4EEW 4WWR 4X86 6AU8
  • PDBsum: 1WX9 2N9P 4DWF 4EEW 4WWR 4X86 6AU8
  • DIP: 31191
  • STRING: ENSP00000365131
• Other Databases: GeneCards:  BAG6  Malacards:  BAG6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001822	kidney development	ISS	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0006810	transport	IEA	biological process
GO:0007130	synaptonemal complex assembly	ISS	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007420	brain development	ISS	biological process
GO:0009790	embryo development	ISS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0018393	internal peptidyl-lysine acetylation	IDA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030324	lung development	ISS	biological process
GO:0030544	Hsp70 protein binding	IEA	molecular function
GO:0031593	polyubiquitin binding	ISS	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0042127	regulation of cell proliferation	IEA	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	biological process
GO:0043022	ribosome binding	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0045861	negative regulation of proteolysis	ISS	biological process
GO:0050821	protein stabilization	ISS	biological process
GO:0051787	misfolded protein binding	IDA	molecular function
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS	biological process
GO:0070628	proteasome binding	ISS	molecular function
GO:0071816	tail-anchored membrane protein insertion into ER membrane	IDA	biological process
GO:0071818	BAT3 complex	IDA	cellular component
GO:0071818	BAT3 complex	IDA	cellular component
GO:0071818	BAT3 complex	IDA	cellular component
GO:1904294	positive regulation of ERAD pathway	IMP	biological process
GO:1904378	maintenance of unfolded protein involved in ERAD pathway	IMP	biological process
GO:1904379	protein localization to cytosolic proteasome complex involved in ERAD pathway	NAS	biological process
GO:1990381	ubiquitin-specific protease binding	IPI	molecular function
GO:0001822	kidney development	IEA	biological process
GO:0001822	kidney development	ISS	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0006810	transport	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0007130	synaptonemal complex assembly	IEA	biological process
GO:0007130	synaptonemal complex assembly	ISS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0007420	brain development	ISS	biological process
GO:0009790	embryo development	IEA	biological process
GO:0009790	embryo development	ISS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0018393	internal peptidyl-lysine acetylation	IDA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0030324	lung development	ISS	biological process
GO:0030544	Hsp70 protein binding	IEA	molecular function
GO:0031593	polyubiquitin binding	IEA	molecular function
GO:0031593	polyubiquitin binding	ISS	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0042127	regulation of cell proliferation	IEA	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0043022	ribosome binding	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0045861	negative regulation of proteolysis	IEA	biological process
GO:0045861	negative regulation of proteolysis	ISS	biological process
GO:0050821	protein stabilization	IEA	biological process
GO:0050821	protein stabilization	ISS	biological process
GO:0051787	misfolded protein binding	IDA	molecular function
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS	biological process
GO:0070628	proteasome binding	IEA	molecular function
GO:0070628	proteasome binding	ISS	molecular function
GO:0071816	tail-anchored membrane protein insertion into ER membrane	IDA	biological process
GO:0071818	BAT3 complex	IDA	cellular component
GO:0071818	BAT3 complex	IDA	cellular component
GO:0071818	BAT3 complex	IDA	cellular component
GO:1904294	positive regulation of ERAD pathway	IMP	biological process
GO:1904378	maintenance of unfolded protein involved in ERAD pathway	IMP	biological process
GO:1904379	protein localization to cytosolic proteasome complex involved in ERAD pathway	NAS	biological process
GO:1990381	ubiquitin-specific protease binding	IPI	molecular function
GO:0001822	kidney development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0007130	synaptonemal complex assembly	ISS	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0007420	brain development	ISS	biological process
GO:0009790	embryo development	ISS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0018393	internal peptidyl-lysine acetylation	IDA	biological process
GO:0030324	lung development	ISS	biological process
GO:0031593	polyubiquitin binding	ISS	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	biological process
GO:0043022	ribosome binding	IDA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0045861	negative regulation of proteolysis	ISS	biological process
GO:0050821	protein stabilization	ISS	biological process
GO:0051787	misfolded protein binding	IDA	molecular function
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS	biological process
GO:0070628	proteasome binding	ISS	molecular function
GO:0071816	tail-anchored membrane protein insertion into ER membrane	IDA	biological process
GO:0071818	BAT3 complex	IDA	cellular component
GO:0071818	BAT3 complex	IDA	cellular component
GO:0071818	BAT3 complex	IDA	cellular component
GO:1904294	positive regulation of ERAD pathway	IMP	biological process
GO:1904378	maintenance of unfolded protein involved in ERAD pathway	IMP	biological process
GO:1904379	protein localization to cytosolic proteasome complex involved in ERAD pathway	NAS	biological process
GO:1990381	ubiquitin-specific protease binding	IPI	molecular function

Diseases

Associated diseases	References
Cancer (adenocarcinoma)	GAD: 19836008
Cancer (lung)	GAD: 18978787
Cancer (esophageal)	GAD: 20453000
Cardiovascular disease	GAD: 20626023
Congenital abnormalities	GAD: 20098615
Arthritis	GAD: 18835879
Systemic lupus erythematosus (SLE)	GAD: 19851445
Male factor infertility	MIK: 26153132
Abortion	GAD: 20587610
Associated with spermatogenesis	MIK: 18678708
Male infertility	MIK: 26153132
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18678708	Associated with spermatogenesis, idiopathic male infertility				Male infertility
29205438	Male infertility			23 (16 infertile men and 7 fertile men)	Male infertility
26153132	Important to study male idiopathic infertility, Male infertility				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray