• Gene id: 79155

Gene Summary

• Gene Symbol: TNIP2   Gene   UCSC   Ensembl
• Aliases: ABIN2, FLIP1, KLIP
• Gene name: TNFAIP3 interacting protein 2
• Alternate names: TNFAIP3-interacting protein 2, A20-binding inhibitor of NF-kappaB activation-2, fetal liver LKB1-interacting protein,
• Gene location: 4p16.3 (2756335: 2741647)     Exons: 6     NC_000004.12
• Gene summary(Entrez): This gene encodes a protein which acts as an inhibitor of NFkappaB activation. The encoded protein is also involved in MAP/ERK signaling pathway in specific cell types. It may be involved in apoptosis of endothelial cells. Alternative splicing results in
• OMIM: 615507

Protein Summary

• Protein general information: Q8NFZ5  
  • Name: TNFAIP3 interacting protein 2 (A20 binding inhibitor of NF kappa B activation 2) (ABIN 2) (Fetal liver LKB1 interacting protein)
  • Length: 429  
  • Mass: 48700
  • Tissue specificity: Ubiquitously expressed in all tissues examined. {ECO
• Sequence:

  MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAAPSLVDALLEQVARFR
  EQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHEREKEVVLLRRSMAEGERARAASDVLCRSLANE
  THQLRRTLTATAHMCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEENRLLKQKVTHVEDLNA
  KWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQMLE
  QQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAGRIHAGSKTAKYLAADALELMVPGGW
  RPGTGSQQPEPPAEGGHPGAAQRGQGDLQCPHCLQCFSDEQGEELLRHVAECCQ

• Structural information:
  • Interpro: IPR032419  IPR022008  IPR034735  
  • Prosite: PS51801
  • PDB: 5H07
  • PDBsum: 5H07
  • DIP: 27617
  • STRING: ENSP00000321203
• Other Databases: GeneCards:  TNIP2  Malacards:  TNIP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031593	polyubiquitin modification-dependent protein binding	IBA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0034134	toll-like receptor 2 signaling pathway	IBA	biological process
GO:0034138	toll-like receptor 3 signaling pathway	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0031593	polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0019901	protein kinase binding	IDA	molecular function
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:0050821	protein stabilization	ISS	biological process
GO:0023035	CD40 signaling pathway	ISS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	ISS	biological process
GO:0050871	positive regulation of B cell activation	ISS	biological process
GO:0043032	positive regulation of macrophage activation	ISS	biological process
GO:0034162	toll-like receptor 9 signaling pathway	ISS	biological process
GO:0034138	toll-like receptor 3 signaling pathway	ISS	biological process
GO:0034134	toll-like receptor 2 signaling pathway	ISS	biological process
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016579	protein deubiquitination	TAS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051403	stress-activated MAPK cascade	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0050821	protein stabilization	IEA	biological process
GO:0023035	CD40 signaling pathway	IEA	biological process
GO:0070498	interleukin-1-mediated signaling pathway	IEA	biological process
GO:0050871	positive regulation of B cell activation	IEA	biological process
GO:0043032	positive regulation of macrophage activation	IEA	biological process
GO:0034162	toll-like receptor 9 signaling pathway	IEA	biological process
GO:0034138	toll-like receptor 3 signaling pathway	IEA	biological process
GO:0034134	toll-like receptor 2 signaling pathway	IEA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881